BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M07 (307 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 4.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 4.5 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 4.5 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 43 DTKSVNTQTLFLRETLQASNLKIKQRKHEIIPRVLK 150 DT ++N F+R +L ++ + + PRV K Sbjct: 28 DTYALNQSLHFVRASLSNLDMSVLECADRSAPRVKK 63 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 4.5 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 43 DTKSVNTQTLFLRETLQASNLKIKQRKHEIIPRVLK 150 DT ++N F+R +L ++ + + PRV K Sbjct: 118 DTYALNQSLHFVRASLSNLDMSVLECADRSAPRVKK 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,671 Number of Sequences: 438 Number of extensions: 1384 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6493812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -