BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M07 (307 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23260.2 68418.m02722 MADS-box protein, putative 25 7.6 At2g03610.1 68415.m00321 F-box family protein contains F-box dom... 25 7.6 >At5g23260.2 68418.m02722 MADS-box protein, putative Length = 252 Score = 25.4 bits (53), Expect = 7.6 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +1 Query: 76 LRETLQASNLKIKQRKHEIIPRVLKGVPKK 165 L L+ S LK+++RK+E++ + L+ + +K Sbjct: 126 LERQLEHSVLKVRERKNELMQQQLENLSRK 155 >At2g03610.1 68415.m00321 F-box family protein contains F-box domain Pfam:PF00646 Length = 216 Score = 25.4 bits (53), Expect = 7.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 234 NSEWNFYFQNSSAIFDLWKCYRRFFRYSLQYSRNYFVFS 118 +S+WN QNS +IFD+ + + Y+L + + FS Sbjct: 63 DSKWN---QNSGSIFDMAYKNSKLYLYTLDHHIKIYDFS 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,934,967 Number of Sequences: 28952 Number of extensions: 77099 Number of successful extensions: 273 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 311361520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -