BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M05 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 28 0.23 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 6.6 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 6.6 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.6 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 27.9 bits (59), Expect = 0.23 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 125 KSPFGGGRPGRVKRKNLRKGQGGGATNDEEE 33 KS GGG R +++ R+G GG + ++EEE Sbjct: 947 KSQGGGG--SRKRKEKARRGSGGDSDSEEEE 975 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 6.6 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -2 Query: 499 SATSVKCGASSTRSLASVRLPVNC*HSRRRILRDCLKAMLYYVVWLGSEC 350 S T ASS + + R P NC R L+ LK Y + +C Sbjct: 18 SRTDGNGAASSCNNSLNPRTPPNCARCRNHGLKIGLKGHKRYCKYRACQC 67 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 6.6 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -2 Query: 499 SATSVKCGASSTRSLASVRLPVNC*HSRRRILRDCLKAMLYYVVWLGSEC 350 S T ASS + + R P NC R L+ LK Y + +C Sbjct: 18 SRTDGNGAASSCNNSLNPRTPPNCARCRNHGLKIGLKGHKRYCKYRACQC 67 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 287 APRSPQSSNRAHNPVSSVSH 346 AP P S+ +H+PV + SH Sbjct: 798 APPHPHSALSSHSPVGAGSH 817 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,909 Number of Sequences: 2352 Number of extensions: 10008 Number of successful extensions: 50 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -