BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M04 (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64848-3|AAB04882.1| 323|Caenorhabditis elegans Hypothetical pr... 28 3.6 AL132948-11|CAC51063.1| 208|Caenorhabditis elegans Hypothetical... 27 8.3 >U64848-3|AAB04882.1| 323|Caenorhabditis elegans Hypothetical protein C50E3.7 protein. Length = 323 Score = 27.9 bits (59), Expect = 3.6 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 34 FFKFLTPITFLTNL---LHHNTICVCIRRSSQKKKLEELLSQFKTY 162 FFK L F+ +L LH TIC+ I S+ + + + LSQ Y Sbjct: 114 FFKILLIQCFVVSLRVFLHILTICIIIYVSNTESSVSKFLSQCSLY 159 >AL132948-11|CAC51063.1| 208|Caenorhabditis elegans Hypothetical protein Y39B6A.13 protein. Length = 208 Score = 26.6 bits (56), Expect = 8.3 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -1 Query: 251 FLFKYLNSNKFLGSNQQT 198 FLFK+L++ +FL S+QQT Sbjct: 74 FLFKFLHAFQFLPSDQQT 91 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,459,346 Number of Sequences: 27780 Number of extensions: 143573 Number of successful extensions: 208 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 208 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -