BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M03 (403 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0247 + 2023019-2023802,2023894-2023997 30 0.79 12_02_0284 - 16791153-16791212,16791392-16791925,16792266-167926... 27 4.2 10_08_0774 + 20478203-20479393 27 4.2 02_05_1277 - 35408097-35409080 27 4.2 03_05_0157 - 21346104-21347693 27 5.6 06_03_0940 + 26145746-26145879,26146740-26146821,26147349-261474... 27 7.3 06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357,199... 27 7.3 02_02_0616 - 12160899-12161506,12161698-12161821,12161974-121620... 27 7.3 10_01_0344 - 3777610-3777758,3777870-3777959,3778950-3779025,377... 26 9.7 10_01_0207 - 2219247-2219902,2220203-2221156,2223739-2224897 26 9.7 01_03_0158 + 13323191-13323436,13324052-13324102 26 9.7 >01_01_0247 + 2023019-2023802,2023894-2023997 Length = 295 Score = 29.9 bits (64), Expect = 0.79 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 269 LTPVSIDPFEFEFILWRRGHFSRIQDLPVAWA 174 LTP I P E I + SR+Q LP +WA Sbjct: 126 LTPFKISPINRELIFLYNCNQSRLQQLPPSWA 157 >12_02_0284 - 16791153-16791212,16791392-16791925,16792266-16792637, 16793754-16794105,16794107-16794795,16821179-16821574 Length = 800 Score = 27.5 bits (58), Expect = 4.2 Identities = 17/70 (24%), Positives = 32/70 (45%) Frame = +3 Query: 60 QYINAATMSFTSITHTCQYNEEDGSMRMYLRGRPVIMYGPSDREVLDPAKVAPPPQNKLK 239 ++ +A FT+I + Q +D ++ Y R + I+ +R+ APP + Sbjct: 728 EWQQSADAQFTNINNMMQQQHDD--LQAYFRFQSSILIKDPERKPSLGGDFAPPTELLCF 785 Query: 240 LEWVYGYRGK 269 + +YG GK Sbjct: 786 ISLIYGVLGK 795 >10_08_0774 + 20478203-20479393 Length = 396 Score = 27.5 bits (58), Expect = 4.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 256 P*THSSLSLFCGGGATLAGSKTSRSLGPYIMTGRP 152 P T S +LF G A LAG+ P++ T P Sbjct: 203 PDTGKSSALFLGASAKLAGAGKGAGTTPFVKTSTP 237 >02_05_1277 - 35408097-35409080 Length = 327 Score = 27.5 bits (58), Expect = 4.2 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +3 Query: 72 AATMSFTSITHTCQYNEEDGSMRMYLRGRPVIMYGPSDREVLDPAKVAPPP 224 A T + T+ T T +++GS + L + + PSD E + P PPP Sbjct: 248 ATTAATTAATATAPDTKKEGSTSINLE-LDLNLPAPSDEESVSPPPPPPPP 297 >03_05_0157 - 21346104-21347693 Length = 529 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 272 LPEQLVSTPNWGDSVLRGSCGSAVQRRGTV--PETLHGAYG*RQM 400 LP++L + WG + +R G++ + R TV L G Y Q+ Sbjct: 56 LPDELRAAARWGAAFVRARLGASEKERHTVVIRRQLDGGYSENQL 100 >06_03_0940 + 26145746-26145879,26146740-26146821,26147349-26147427, 26147527-26147624,26148392-26148479,26148589-26148686, 26148881-26148982,26149237-26149281,26150535-26150574, 26150988-26151074,26151254-26151330,26151746-26151808, 26152650-26152766,26152905-26153116,26153690-26153785, 26153869-26153935,26154028-26154081 Length = 512 Score = 26.6 bits (56), Expect = 7.3 Identities = 20/76 (26%), Positives = 35/76 (46%) Frame = -3 Query: 350 DVEQHYHSCHEVHYLPSWE*IQVAPAILTPVSIDPFEFEFILWRRGHFSRIQDLPVAWAV 171 + +H+ HE H L +Q IL+P ++ + +E +L + + Q L V + Sbjct: 98 EARSFFHTFHEDHELMHSRDLQKLEGILSPSHLE-YSYELLL---QYLQKTQAL-VVLGI 152 Query: 170 HNDRPASEVHPH*PVL 123 N+R +V P P L Sbjct: 153 INERTTFDVSPGQPSL 168 >06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357, 1990434-1990621,1990711-1990835,1990988-1991039, 1991585-1991874,1992229-1992307,1992527-1992657 Length = 464 Score = 26.6 bits (56), Expect = 7.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 177 PSDREVLDPAKVAPPPQ 227 P+ E LDP APPPQ Sbjct: 31 PASEEALDPQTPAPPPQ 47 >02_02_0616 - 12160899-12161506,12161698-12161821,12161974-12162083, 12162119-12162271,12162545-12162779 Length = 409 Score = 26.6 bits (56), Expect = 7.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 242 RMGLWIQG*GLPEQLVSTPNW 304 R W +G GLP Q+++ P W Sbjct: 143 RAAKWFRGVGLPWQVITWPQW 163 >10_01_0344 - 3777610-3777758,3777870-3777959,3778950-3779025, 3779206-3779288,3780456-3780799,3782064-3782113, 3782406-3782542,3782692-3782776 Length = 337 Score = 26.2 bits (55), Expect = 9.7 Identities = 8/36 (22%), Positives = 24/36 (66%) Frame = +3 Query: 147 LRGRPVIMYGPSDREVLDPAKVAPPPQNKLKLEWVY 254 ++ + + +GP + V++ +VAPP + +++L+ ++ Sbjct: 25 IKCKAAVAHGPGEALVMEEVEVAPPARMEVRLKVLF 60 >10_01_0207 - 2219247-2219902,2220203-2221156,2223739-2224897 Length = 922 Score = 26.2 bits (55), Expect = 9.7 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 168 MYGPSDREVLDPAKVAPPPQNKLKLEWVYGYRGKDCRSNLYLL 296 ++ P R VLDP + PP + L+L+ CR L L+ Sbjct: 85 LHHPVFRSVLDPPDLIPPDRFALRLDDYRAASLLGCRHGLVLI 127 >01_03_0158 + 13323191-13323436,13324052-13324102 Length = 98 Score = 26.2 bits (55), Expect = 9.7 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 137 EDVPPRPAGHYVRPKRPGGLGSC*SGPAATE*TQTRMGLWIQG*G 271 ED P P V P PGG GS S P E R L I G G Sbjct: 2 EDFFPAPRDALVDPDTPGGSGS--SFPVPAELKSKRRRLVIPGGG 44 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,765,456 Number of Sequences: 37544 Number of extensions: 287309 Number of successful extensions: 781 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -