BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M01 (385 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC051740-1|AAH51740.1| 675|Homo sapiens SLC44A5 protein protein. 29 5.1 BC034580-1|AAH34580.1| 675|Homo sapiens SLC44A5 protein protein. 29 5.1 BC028743-1|AAH28743.1| 719|Homo sapiens solute carrier family 4... 29 5.1 AK093170-1|BAC04084.1| 717|Homo sapiens protein ( Homo sapiens ... 29 5.1 AK091400-1|BAC03655.1| 403|Homo sapiens protein ( Homo sapiens ... 29 5.1 >BC051740-1|AAH51740.1| 675|Homo sapiens SLC44A5 protein protein. Length = 675 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 230 NRLFFNPLSTYLAFTSAFHCFPIVLFLWVIDILI 331 N F+ S Y + FH + + +FLW+I+ +I Sbjct: 397 NFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVI 430 >BC034580-1|AAH34580.1| 675|Homo sapiens SLC44A5 protein protein. Length = 675 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 230 NRLFFNPLSTYLAFTSAFHCFPIVLFLWVIDILI 331 N F+ S Y + FH + + +FLW+I+ +I Sbjct: 397 NFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVI 430 >BC028743-1|AAH28743.1| 719|Homo sapiens solute carrier family 44, member 5 protein. Length = 719 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 230 NRLFFNPLSTYLAFTSAFHCFPIVLFLWVIDILI 331 N F+ S Y + FH + + +FLW+I+ +I Sbjct: 439 NFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVI 472 >AK093170-1|BAC04084.1| 717|Homo sapiens protein ( Homo sapiens cDNA FLJ35851 fis, clone TESTI2007040, moderately similar to Homo sapiens CTL2 gene. ). Length = 717 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 230 NRLFFNPLSTYLAFTSAFHCFPIVLFLWVIDILI 331 N F+ S Y + FH + + +FLW+I+ +I Sbjct: 439 NFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVI 472 >AK091400-1|BAC03655.1| 403|Homo sapiens protein ( Homo sapiens cDNA FLJ34081 fis, clone FCBBF3004261, moderately similar to Homo sapiens CTL2 gene. ). Length = 403 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 230 NRLFFNPLSTYLAFTSAFHCFPIVLFLWVIDILI 331 N F+ S Y + FH + + +FLW+I+ +I Sbjct: 123 NFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVI 156 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,695,451 Number of Sequences: 237096 Number of extensions: 868723 Number of successful extensions: 896 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2583773550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -