BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L24 (515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C11.02c |rps23||40S ribosomal protein S23|Schizosaccharomy... 236 1e-63 SPBP4H10.13 |rps2302|rps23-2|40S ribosomal protein S23|Schizosac... 236 1e-63 SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizo... 49 5e-07 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 30 0.24 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 27 1.7 SPBC14C8.15 |||triglyceride lipase-cholesterol esterase |Schizos... 26 3.8 SPCC4G3.06c |mrpl4||mitochondrial ribosomal protein subunit L4|S... 25 6.7 SPBC56F2.12 |ilv5||acetohydroxyacid reductoisomerase|Schizosacch... 25 8.9 >SPAC23C11.02c |rps23||40S ribosomal protein S23|Schizosaccharomyces pombe|chr 1|||Manual Length = 143 Score = 236 bits (578), Expect = 1e-63 Identities = 108/143 (75%), Positives = 125/143 (87%) Frame = +1 Query: 34 MGKPRGIRTARKHVNHRREQRWADKEFKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAK 213 MGKP G+ ARK NHRRE+RWAD +KK +GT +K++PFGG+SHAKGIV+EK+GVEAK Sbjct: 1 MGKPAGLNAARKLRNHRREERWADAHYKKRLLGTAYKSSPFGGSSHAKGIVVEKIGVEAK 60 Query: 214 QPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRF 393 QPNSAIRKCVRVQLIKNGKKVTAFVP DGCLN ++ENDEVL++GFGRKG A GDIPGVRF Sbjct: 61 QPNSAIRKCVRVQLIKNGKKVTAFVPHDGCLNFVDENDEVLLSGFGRKGKAKGDIPGVRF 120 Query: 394 KVVKVANVSLLALYKEKKERPRS 462 KVVKVA V L AL+ EKKE+PR+ Sbjct: 121 KVVKVAGVGLSALFHEKKEKPRA 143 >SPBP4H10.13 |rps2302|rps23-2|40S ribosomal protein S23|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 236 bits (578), Expect = 1e-63 Identities = 108/143 (75%), Positives = 125/143 (87%) Frame = +1 Query: 34 MGKPRGIRTARKHVNHRREQRWADKEFKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAK 213 MGKP G+ ARK NHRRE+RWAD +KK +GT +K++PFGG+SHAKGIV+EK+GVEAK Sbjct: 1 MGKPAGLNAARKLRNHRREERWADAHYKKRLLGTAYKSSPFGGSSHAKGIVVEKIGVEAK 60 Query: 214 QPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRF 393 QPNSAIRKCVRVQLIKNGKKVTAFVP DGCLN ++ENDEVL++GFGRKG A GDIPGVRF Sbjct: 61 QPNSAIRKCVRVQLIKNGKKVTAFVPHDGCLNFVDENDEVLLSGFGRKGKAKGDIPGVRF 120 Query: 394 KVVKVANVSLLALYKEKKERPRS 462 KVVKVA V L AL+ EKKE+PR+ Sbjct: 121 KVVKVAGVGLSALFHEKKEKPRA 143 >SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 48.8 bits (111), Expect = 5e-07 Identities = 31/82 (37%), Positives = 49/82 (59%) Frame = +1 Query: 160 GASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLV 339 G+ +G+ V+ K+PNSA+RK RV+L G+ VTA++P G ++ +E+ VL+ Sbjct: 47 GSPFRRGVCTRVFTVKPKKPNSAVRKVARVRL-STGRSVTAYIP--GIGHNAQEHAVVLL 103 Query: 340 AGFGRKGHAVGDIPGVRFKVVK 405 G GR D PGV++ VV+ Sbjct: 104 RG-GR----AQDCPGVQYHVVR 120 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 29.9 bits (64), Expect = 0.24 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 440 SLYRARSDTFATLTTLNLTPGMSPTAWP 357 S Y+ + DT+AT TLN PT WP Sbjct: 1151 SKYKIK-DTYATFQTLNYIQNQQPTKWP 1177 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = -1 Query: 440 SLYRARSDTFATLTTLNLTPGMSPTAWPLRPNPATNTSSFSSM 312 ++Y + + +F T ++++ G S L P PA++TSSFS++ Sbjct: 161 TIYSSATSSFPYSTDVSVSTGTSTDIVTLPP-PASSTSSFSTI 202 >SPBC14C8.15 |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 2|||Manual Length = 460 Score = 25.8 bits (54), Expect = 3.8 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = -3 Query: 210 GFNANFFEDDALSMRCTTEGVRLPSRTHVGFFEFLVGPSLLATMIHVLARRANTPRFTHY 31 GF +++ + R E +RLP G + +V L T + L++ P + H Sbjct: 350 GFKPSYYTNLNRIARYPIENIRLPITLVYGSNDNMVDIETLKTQLPPLSQCIQIPNYEHL 409 Query: 30 D 28 D Sbjct: 410 D 410 >SPCC4G3.06c |mrpl4||mitochondrial ribosomal protein subunit L4|Schizosaccharomyces pombe|chr 3|||Manual Length = 144 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 62 AVRIPRGLPITIARTRSAPR 3 AVRIP+G + + +SAP+ Sbjct: 12 AVRIPKGFVFPVPKVKSAPK 31 >SPBC56F2.12 |ilv5||acetohydroxyacid reductoisomerase|Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 24.6 bits (51), Expect = 8.9 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 289 PRDGCLNHIEENDEVLVAGFGRKGHAVG 372 PR+ +++ + ND + + G+G +GH G Sbjct: 74 PREKLVDYFK-NDTLAIIGYGSQGHGQG 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,263,702 Number of Sequences: 5004 Number of extensions: 46721 Number of successful extensions: 110 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -