BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L23 (425 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k... 29 6.6 >AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase kappa protein. Length = 1271 Score = 29.1 bits (62), Expect = 6.6 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 19 EPSPPVAVDALPNMAQDPICEKMVDLIPELPAVPELKTEMLQETSNDVV 165 EP+P A ++ P +P E + + PEL PE+ E+ E + + V Sbjct: 112 EPAPEPATESAPEPTPEPALESVPEPAPEL--TPEVAPELAPEPTPEPV 158 Score = 29.1 bits (62), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 19 EPSPPVAVDALPNMAQDPICEKMVDLIPEL--PAVPELK 129 EP+P + + P +A +P E + +L PE A PE + Sbjct: 136 EPAPELTPEVAPELAPEPTPEPVTELAPEFCPEAAPEFR 174 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,412,759 Number of Sequences: 237096 Number of extensions: 1048087 Number of successful extensions: 2019 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2018 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3316445452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -