BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L22 (574 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41680.2 68418.m05065 protein kinase family protein contains ... 27 8.9 >At5g41680.2 68418.m05065 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to receptor-like protein kinase (GI:4008006) [Arabidopsis thaliana]; similar to receptor-like kinase RHG1 (GI:21239380) (GI:21239382) [Glycine max] Length = 333 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 104 HMNITSHKIYAYS*LIKSTLYIFYSP--IF*HLSGETVVSIE 223 H N+ K Y YS + K +Y +YS +F L GE+ V ++ Sbjct: 111 HDNVAELKAYYYSKIDKLAVYSYYSQGNLFEMLHGESQVPLD 152 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,120,000 Number of Sequences: 28952 Number of extensions: 171916 Number of successful extensions: 292 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -