BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L21 (489 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 25 0.37 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 24 0.85 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 25.0 bits (52), Expect = 0.37 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 17 PEEIRKTFNIKNDFTAAEEDQVRKENEWCEE 109 PE R I DFTA++ D+ + W E+ Sbjct: 170 PEGSRTPIEIPQDFTASDLDEEHRVAYWRED 200 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.8 bits (49), Expect = 0.85 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = +2 Query: 5 EGKT--PEEIRKTFNIKNDF 58 EGK PE ++K +NI+N+F Sbjct: 46 EGKVQVPEALKKIYNIQNNF 65 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,103 Number of Sequences: 336 Number of extensions: 1742 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -