BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L21 (489 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23671| Best HMM Match : Tetraspannin (HMM E-Value=6.6e-38) 29 2.7 SB_29935| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-06) 27 6.3 >SB_23671| Best HMM Match : Tetraspannin (HMM E-Value=6.6e-38) Length = 919 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 215 CFPIVKFNCVIKVLSYFLNLVGLYSLTISFGIIRIFYKFSI 337 C ++K N I V SY + LV ++ L I+ G++ + Y+ I Sbjct: 78 CVAVIKENRFILV-SYLIMLVLIFILEIATGVVAVIYRSEI 117 >SB_29935| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-06) Length = 353 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +2 Query: 14 TPEEIRKTFNIK--NDFTAAE-EDQVRKENEWCEEK*YVE 124 T +E+R TFNIK N F A E ED+ + E + K VE Sbjct: 297 TEKEVRNTFNIKLRNRFQALEQEDEEERGEEVVDAKEEVE 336 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,319,044 Number of Sequences: 59808 Number of extensions: 177395 Number of successful extensions: 320 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 320 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -