BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L20 (492 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0327 - 23154014-23154942,23155169-23155316,23155606-231566... 27 8.2 01_04_0008 + 15041682-15041909,15042035-15042319,15042406-150427... 27 8.2 >03_05_0327 - 23154014-23154942,23155169-23155316,23155606-23156622, 23156753-23157217,23160258-23161247 Length = 1182 Score = 27.1 bits (57), Expect = 8.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 264 IFSLKYPNKIFESKRLLLNYSVGCLNEVNSIQTQIC 157 +FS + +++FE+ +L V C E+ I+ IC Sbjct: 674 VFSSGWSDEMFEALTNILQSKVSCFAEIYDIEPPIC 709 >01_04_0008 + 15041682-15041909,15042035-15042319,15042406-15042723, 15044087-15044128,15045111-15045391,15045808-15045883, 15046196-15046296,15047971-15048088,15048872-15049186 Length = 587 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 334 FTLRQVKGDVQMALCALLCCHN*NI 260 FTL Q+K VQ L L CHN N+ Sbjct: 167 FTLPQIKCYVQQLLSGLEHCHNNNV 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,616,902 Number of Sequences: 37544 Number of extensions: 178849 Number of successful extensions: 248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 248 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1023611560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -