BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L20 (492 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16220| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.90 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 >SB_16220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 30.3 bits (65), Expect = 0.90 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 327 SVKCPY*YNELNYIIVNC--LGTWTTSLISVYALCAM*GDLIS 449 +V+ P Y L++I + C +G+W SL+S+Y C D+IS Sbjct: 284 AVRRPLRYRVLSHIFIKCSLIGSWVYSLLSLY--CIFGYDIIS 324 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 333 LHCVK*KVTFRW-RFVRFCVATIKIFSLKYPNKI 235 L K +VT W R VR C+A+ K S+K+P+ I Sbjct: 2687 LRTCKTRVTSSWPRRVRCCIASEKKGSIKFPHSI 2720 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,169,192 Number of Sequences: 59808 Number of extensions: 237251 Number of successful extensions: 384 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -