BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L19 (551 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.14 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 2.3 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 4.1 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 5.4 AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 21 5.4 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 21 5.4 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 5.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.14 Identities = 33/110 (30%), Positives = 44/110 (40%), Gaps = 16/110 (14%) Frame = +3 Query: 114 NQIGAKFWEIISDEHGIDPTGAYHGDS-----DLQLERINVYYNEASG-GKYVPRAILVD 275 N+I + W + D G AYHGD D++ R Y + G G V A +D Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKAEYIKTKGFGGAV--AWTID 968 Query: 276 LEP-------GTMDSVRSEPFGQIFLPDNVCFPD---SPAPVTTGPRDTT 395 L+ G+ +RS G +PDN D P PVT P T Sbjct: 969 LDDFSNRCCGGSFPLLRSLNRGLGLIPDNPSREDCTKPPEPVTPAPPQVT 1018 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 22.6 bits (46), Expect = 2.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 409 LSALCVVSLGPVVTGAGLSGKQT 341 LS+ LG V GAG SGK T Sbjct: 269 LSSASNAKLGAPVKGAGNSGKYT 291 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 100 LECARSSFYFLF*FNKIVNKLLT 32 L CA SFY F ++N+L+T Sbjct: 73 LFCASLSFYKAFKIGILLNQLIT 95 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 Query: 202 CKSESPWYAPVGSMPC 155 C +E PW G PC Sbjct: 351 CVNERPWSLYCGEPPC 366 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 403 ALCVVSLGPVVTGAGLSGK 347 ALC++SLG ++ L GK Sbjct: 71 ALCLMSLGMFLSRVPLGGK 89 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 403 ALCVVSLGPVVTGAGLSGK 347 ALC++SLG ++ L GK Sbjct: 71 ALCLMSLGMFLSRVPLGGK 89 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 330 LPDNVCFPDSPAPVTTGPRDTTQR 401 L + C PD P P+ RD + R Sbjct: 180 LREERCDPDRPLPLDQKARDLSPR 203 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,243 Number of Sequences: 336 Number of extensions: 2305 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -