SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_L18
         (407 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y17705-1|CAA76825.1|  124|Anopheles gambiae opsin protein.             24   2.5  
AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein...    24   2.5  
EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.          22   7.5  
EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.          22   7.5  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    22   7.5  
AB107248-1|BAE72063.1|  278|Anopheles gambiae Bcl-2 family prote...    22   7.5  
M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    22   9.9  
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    22   9.9  
AF513639-1|AAM53611.1|  195|Anopheles gambiae glutathione S-tran...    22   9.9  

>Y17705-1|CAA76825.1|  124|Anopheles gambiae opsin protein.
          Length = 124

 Score = 23.8 bits (49), Expect = 2.5
 Identities = 13/39 (33%), Positives = 23/39 (58%)
 Frame = -3

Query: 369 ACDTQTDLAFSRVQF*LTSITPMFMPMLPHLSDSLTGIY 253
           A +T T++  ++V   L +I+  FM   P+L  + TGI+
Sbjct: 59  AQNTSTEMKLAKVA--LVTISLWFMAWTPYLVINFTGIF 95


>AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 695

 Score = 23.8 bits (49), Expect = 2.5
 Identities = 21/76 (27%), Positives = 32/76 (42%)
 Frame = -3

Query: 294 PMLPHLSDSLTGIYCCQQ*GSKAPQRLPSKDDNHRCFRRR*ADLSHASLLWSLSITAPMD 115
           P LP L+     + C     +  PQ    K D   C +   AD ++   +  +++  P+ 
Sbjct: 383 PRLPSLAGVNMAMVCRS---NSYPQLEQVKQDRPICCQEY-ADCANRHSV--VTLPQPVT 436

Query: 114 EMQGIVPVPLEPGLSC 67
              G V VP  PGL C
Sbjct: 437 AAGGGVVVPFTPGLQC 452


>EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.
          Length = 160

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 94  QGTYRWALTGRPV 106


>EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 96  QGTYRWALTGRPV 108


>EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 81  QGTYRWALTGRPV 93


>EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 81  QGTYRWALTGRPV 93


>EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 91  QGTYRWALTGRPV 103


>EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 91  QGTYRWALTGRPV 103


>EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 97  QGTYRWALTGRPV 109


>EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 98  QGTYRWALTGRPV 110


>EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 97  QGTYRWALTGRPV 109


>EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 85  QGTYRWALTGRPV 97


>EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 85  QGTYRWALTGRPV 97


>EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 85  QGTYRWALTGRPV 97


>EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 88  QGTYRWALTGRPV 100


>EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 99  QGTYRWALTGRPV 111


>EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 96  QGTYRWALTGRPV 108


>EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 108 QGTYRWALTGRPV 120


>EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 108 QGTYRWALTGRPV 120


>EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 108 QGTYRWALTGRPV 120


>EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 98  QGTYRWALTGRPV 110


>EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -1

Query: 386 QRTYRWLATLRPI 348
           Q TYRW  T RP+
Sbjct: 81  QGTYRWALTGRPV 93


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = -2

Query: 337 ARAVLTDKHYAHVHANVAPFERLANRYLLLPA 242
           A  V+ D++  H H + +P   +A    LLP+
Sbjct: 902 AGMVINDENNLHYHRSASPKATVAGGLPLLPS 933


>AB107248-1|BAE72063.1|  278|Anopheles gambiae Bcl-2 family protein
           Anob-1 protein.
          Length = 278

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = +2

Query: 101 IPCISSIGAVMERLHKRL 154
           +P ++ +G  +ER+H RL
Sbjct: 118 LPILNGMGEELERMHPRL 135


>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = +1

Query: 43  DIRAKLDMATKSRFERNWHNTLHFVHWC 126
           DI+  L +++ S      H    FVHWC
Sbjct: 705 DIKIFLPVSSSSDCMSLQHYLNAFVHWC 732


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +1

Query: 109  HFVHWCRYGETP 144
            HFVH C  G+ P
Sbjct: 1124 HFVHLCNRGQWP 1135


>AF513639-1|AAM53611.1|  195|Anopheles gambiae glutathione
           S-transferase S1-2 protein.
          Length = 195

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = -2

Query: 112 NAGYCASSSRTWT*LPYPA*L*YLS 38
           N GY A+S  +W  + + A L YL+
Sbjct: 132 NNGYLANSKLSWADIYFTAILDYLN 156


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 462,154
Number of Sequences: 2352
Number of extensions: 8855
Number of successful extensions: 56
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 32922351
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -