BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L15 (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 53 1e-07 At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 47 7e-06 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 44 8e-05 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 43 1e-04 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 42 2e-04 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 35 0.039 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 35 0.039 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 31 0.47 At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein si... 30 1.1 At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) fa... 30 1.1 At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR... 29 1.4 At1g23270.1 68414.m02911 hypothetical protein 29 2.5 At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P1... 28 3.3 At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) fa... 28 3.3 At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) fa... 28 3.3 At1g65780.1 68414.m07465 tRNA-splicing endonuclease positive eff... 28 3.3 At4g37110.1 68417.m05256 expressed protein 28 4.4 At4g15075.1 68417.m02316 hypothetical protein 28 4.4 At1g13540.1 68414.m01587 expressed protein 28 4.4 At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) fa... 27 5.8 At2g46160.1 68415.m05740 zinc finger (C3HC4-type RING finger) fa... 27 5.8 At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 23 6.3 At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein ... 27 7.7 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 52.8 bits (121), Expect = 1e-07 Identities = 30/109 (27%), Positives = 59/109 (54%), Gaps = 1/109 (0%) Frame = +2 Query: 131 TDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHANYRAITN-LKRQFPQLRVF 307 TD++ +L THL A ++A++Y++ N A + A T ++++ P ++ Sbjct: 21 TDIDSSLF--THLFCTFADLEAESYEITIATWN------QAPFHAFTETVQQRNPHVKTL 72 Query: 308 LTVGGDDDTEDPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 L++GG + +D + + +P +R +F S + +A YGF G+DL W+ Sbjct: 73 LSIGGGNADKDA--FASMASNPDSRASFIQSTITVARSYGFHGLDLDWE 119 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 47.2 bits (107), Expect = 7e-06 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 1/109 (0%) Frame = +2 Query: 131 TDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHANYRAITN-LKRQFPQLRVF 307 TD++ +L THL A + + T ++ + N + T ++R+ P ++ Sbjct: 42 TDIDSSLF--THLFCAFADLNSQTNQVTVSSAN------QPKFSTFTQTVQRRNPSVKTL 93 Query: 308 LTVGGDDDTEDPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 L++GG D Y + +P +R +F +S++ +A YGF G+DL W+ Sbjct: 94 LSIGGG--IADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWE 140 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 43.6 bits (98), Expect = 8e-05 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 1/102 (0%) Frame = +2 Query: 152 SFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHANYRAITN-LKRQFPQLRVFLTVGGDD 328 S THL A I TY+++ + N + T ++R+ P ++ L++GGD Sbjct: 45 SLFTHLFCAFADINTLTYQVIVSSRN------KPKFSTFTQTVRRRNPTVKTLLSIGGDF 98 Query: 329 DTEDPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 + + +P +R F +S++ LA GF G+DL+W+ Sbjct: 99 TYNFA--FASMASNPTSRKLFISSSIKLARSCGFHGLDLNWK 138 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 43.2 bits (97), Expect = 1e-04 Identities = 27/98 (27%), Positives = 50/98 (51%) Frame = +2 Query: 161 THLLYKSAGIQADTYKMVSLNENLDIDRAHANYRAITNLKRQFPQLRVFLTVGGDDDTED 340 THL A + T +V + ++ +N+ I +K++ P ++ L++GG + D Sbjct: 39 THLFCAFADLDPQTNSVVVSGAH---EQEFSNFTKI--VKKKNPHVQTLLSIGGRN--AD 91 Query: 341 PQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 + + +P +R +F SA+ A Y FDG+DL W+ Sbjct: 92 KSAFASMASNPTSRKSFIWSAISSARYYRFDGLDLVWK 129 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 42.3 bits (95), Expect = 2e-04 Identities = 34/137 (24%), Positives = 67/137 (48%), Gaps = 2/137 (1%) Frame = +2 Query: 50 SPSSQSKVLCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNEN 229 SPS++ K ++ E+Q + + P+ F THL A + A+++K+ Sbjct: 9 SPSAEVKASYWFPDG----ETQDPITSAETIPSALF-THLFCAFADLDANSHKVF----- 58 Query: 230 LDIDRAHAN-YRAITN-LKRQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSA 403 + +AH + T +K + PQ++ L++GG + + + + Q+R F +S Sbjct: 59 --VSQAHEFIFSTFTETVKIRNPQVKTLLSIGGKNANNSA--FASMASNHQSRKTFIDSW 114 Query: 404 LLLAEQYGFDGIDLSWQ 454 + +A GF G+DL+W+ Sbjct: 115 IFIARSNGFHGLDLAWE 131 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 34.7 bits (76), Expect = 0.039 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 359 LLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 + S R +F S + +A YGFDG+DL W+ Sbjct: 1 MASSSYGRKSFILSTISIARSYGFDGLDLDWE 32 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 34.7 bits (76), Expect = 0.039 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 1/124 (0%) Frame = +2 Query: 86 DSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHANYRA 265 D KS E ++ P+ + F THL A + + T+++ N + + Sbjct: 22 DGKSQSPECLSQGTPSSFIDSTLF-THLFCAFADVDSSTHEVTISAAN------SYQFSS 74 Query: 266 ITN-LKRQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSALLLAEQYGFDGID 442 T +K + ++ L++GG D D + + + R AF +S++ +A + F G+D Sbjct: 75 FTETVKEKNTDVQTLLSIGGKD--ADKAVLASMASNSKNRKAFIDSSIDIARKKDFYGLD 132 Query: 443 LSWQ 454 L+W+ Sbjct: 133 LAWE 136 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 31.1 bits (67), Expect = 0.47 Identities = 16/60 (26%), Positives = 33/60 (55%) Frame = +2 Query: 275 LKRQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 +K + ++ L++GG D D + + + R AF +S++ +A + F G+DL+W+ Sbjct: 71 VKDKNTDVQTLLSIGGKD--ADKAVLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWE 128 >At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 289 Score = 29.9 bits (64), Expect = 1.1 Identities = 10/32 (31%), Positives = 22/32 (68%) Frame = +2 Query: 359 LLESPQARTAFTNSALLLAEQYGFDGIDLSWQ 454 ++ + +R +F +S++ +A GF G+DL+W+ Sbjct: 79 IVSNRTSRESFISSSISIARSLGFYGLDLAWE 110 >At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 401 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 48 HHLVAKAKSSATMTARAISEN-LKHVCCLRTWSLLFRSAPICCTNLPASKLT 200 H V K +AR + N + H C+ W + S P+C LPA LT Sbjct: 200 HCAVCKENFVLKSSAREMPCNHIYHPDCILPWLAIRNSCPVCRHELPAEDLT 251 >At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1036 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 153 RSAPICCTNLPASKLTHIKWFHSM 224 RS PIC T P+S +H KW H + Sbjct: 13 RSCPICATPFPSSSSSH-KWTHQV 35 >At1g23270.1 68414.m02911 hypothetical protein Length = 180 Score = 28.7 bits (61), Expect = 2.5 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 1/113 (0%) Frame = -1 Query: 459 GNCQDRSIPSKPYCSARRRAEL-VKAVRACGDSNKRLYFCGSSVSSSPPTVKNTRN*GNC 283 G D ++P+ P RR L V + S K+L +S++S P K R + Sbjct: 36 GFTDDTALPTNPETRLRRLKSLPVSRTDSVSSSPKKLLSHSNSMASHPE--KKYRGNVSS 93 Query: 282 LFKFVIAR*LACARSMSKFSLSETILYVSAWMPADLYSRWVQNERAGSKSVGS 124 + F I +C S + ET ++ + SR E +GSK +GS Sbjct: 94 VSSFSIQVGKSCPLDSS---VEETQIFSKTKRNQSVKSRGGLGESSGSKRIGS 143 >At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P14714 Phytochrome C {Arabidopsis thaliana} Length = 1111 Score = 28.3 bits (60), Expect = 3.3 Identities = 24/89 (26%), Positives = 38/89 (42%) Frame = -1 Query: 393 VKAVRACGDSNKRLYFCGSSVSSSPPTVKNTRN*GNCLFKFVIAR*LACARSMSKFSLSE 214 V ++R GD+ + ++ SS R G C+ VIAR A + M + L Sbjct: 987 VSSMRLYGDNLRLQQILSETLLSSIRFTPALR--GLCVSFKVIARIEAIGKRMKRVELEF 1044 Query: 213 TILYVSAWMPADLYSRWVQNERAGSKSVG 127 I++ + +P DL Q R G+ G Sbjct: 1045 RIIHPAPGLPEDLVREMFQPLRKGTSREG 1073 >At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 525 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 128 PTDLEPALSFCTHLLYKSAG 187 PTD P+LSFC +Y S G Sbjct: 321 PTDPNPSLSFCPSNIYSSTG 340 >At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHX1a [Arabidopsis thaliana] GI:3790591; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 423 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 117 HVCCLRTWSLLFRSAPICCTNLPASKLTH 203 HV C+ TW L + P+C +NL + +H Sbjct: 150 HVECIDTWLLSHSTCPLCRSNLLSGFSSH 178 >At1g65780.1 68414.m07465 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 1065 Score = 28.3 bits (60), Expect = 3.3 Identities = 23/86 (26%), Positives = 38/86 (44%) Frame = +2 Query: 167 LLYKSAGIQADTYKMVSLNENLDIDRAHANYRAITNLKRQFPQLRVFLTVGGDDDTEDPQ 346 LL+ +A A Y + + L ID A +++ Q P LR + VG + Sbjct: 547 LLFSTASCSARLYTGTPI-QLLVIDEAAQLKECESSIPMQLPGLRHLILVGDERQLPAMV 605 Query: 347 KYNLLLESPQARTAFTNSALLLAEQY 424 + + LE+ R+ F ALL ++Y Sbjct: 606 ESQIALEAGFGRSLFERLALLGHKKY 631 >At4g37110.1 68417.m05256 expressed protein Length = 417 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 212 PFYMCQLGCRQICTADGCRTKEQAPSP*AAY-VLEIL*YSSCCH 84 P ++C + CR IC CRTK+ AAY + L Y S H Sbjct: 228 PDWICPV-CRDICNCSFCRTKKGWLPTGAAYRKIHKLGYKSVAH 270 >At4g15075.1 68417.m02316 hypothetical protein Length = 168 Score = 27.9 bits (59), Expect = 4.4 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 111 LKHVCCLRTWSLLFRSAP 164 L++ CCL+T ++LF+S P Sbjct: 126 LRNACCLKTATILFKSTP 143 >At1g13540.1 68414.m01587 expressed protein Length = 381 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 293 QLRVFLTVGGDDDTEDPQKYNLLLESPQARTAF 391 +L V +GGDD T DP + +L+ P + + Sbjct: 65 KLAVTFNIGGDDSTRDPVVFIPVLDKPLSSNCY 97 >At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 396 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 117 HVCCLRTWSLLFRSAPICCTNLPAS 191 HV C+ W L S P+C LP+S Sbjct: 282 HVRCIVPWLELHSSCPVCRFELPSS 306 >At2g46160.1 68415.m05740 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 214 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 117 HVCCLRTWSLLFRSAPIC 170 H+CCL W L S P+C Sbjct: 162 HLCCLDAWLKLNGSCPVC 179 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 23.0 bits (47), Expect(2) = 6.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 149 LSFCTHLLYKSAGIQADTYKMVSLNENLDIDR 244 LS C HLL S G+ A+ +E LD+++ Sbjct: 542 LSLCKHLL--SEGMGAEAASQAFNSEKLDMEK 571 Score = 22.6 bits (46), Expect(2) = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 44 PASPSSQSKVLCYYDSKSYIRESQARMLPTDLE 142 P+ P SQS C+ SK +RE ++ D E Sbjct: 486 PSQPLSQSFDPCFNTSKLDLREDESSSGGLDAE 518 >At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 381 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 345 CGSSVSSSPPTVKNTRN*GNCLF 277 CG S SSSP +V + +N CLF Sbjct: 177 CGGSPSSSPASVLSNKNNRCCLF 199 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,503,947 Number of Sequences: 28952 Number of extensions: 200285 Number of successful extensions: 649 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -