Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_L14
         (406 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB065639-1|BAC05865.1|  251|Homo sapiens seven transmembrane hel...    29   5.9  

>AB065639-1|BAC05865.1|  251|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 251

 Score = 29.1 bits (62), Expect = 5.9
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +3

Query: 210 ILFCKIHTLYLCVIKSV*TFIKYTNILYTLYNRHYFI*NLRFISMFFFQIIILHIIGNSL 389
           +LF     LYL ++      I   ++ ++L+   YF   +  IS  F+  +IL  +  +L
Sbjct: 24  VLFAVFLCLYLIILSGNIIIISVIHLDHSLHTPMYFFLGILSISEIFYTTVILPKMLINL 83

Query: 390 FNIY 401
           F+++
Sbjct: 84  FSVF 87


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,904,785
Number of Sequences: 237096
Number of extensions: 779200
Number of successful extensions: 4628
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4623
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4628
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2985693880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)