BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L08 (429 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom... 25 5.0 SPAC56E4.06c |ggt2||gamma-glutamyltranspeptidase Ggt2|Schizosacc... 24 8.7 >SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 25.0 bits (52), Expect = 5.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 335 HSLLTAPRQPLRGLCVSAVSILFCIFI 415 H L+T R+PL LC + IL + + Sbjct: 267 HILVTTIRRPLHLLCTQPIMILISLIV 293 >SPAC56E4.06c |ggt2||gamma-glutamyltranspeptidase Ggt2|Schizosaccharomyces pombe|chr 1|||Manual Length = 611 Score = 24.2 bits (50), Expect = 8.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 426 LYHSINIQNSMETALTQRPLRGCRGAVSSE 337 L +SI+ T T +RG RGAV+SE Sbjct: 58 LVYSISSNLHTPTQFTGHKVRGRRGAVASE 87 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,532,647 Number of Sequences: 5004 Number of extensions: 24235 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -