BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L08 (429 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43240.1 68415.m05374 nucleotide-sugar transporter family pro... 27 7.1 >At2g43240.1 68415.m05374 nucleotide-sugar transporter family protein weak similarity to SP|P78382 CMP-sialic acid transporter {Homo sapiens}; contains Pfam profile PF04142: Nucleotide-sugar transporter Length = 787 Score = 26.6 bits (56), Expect = 7.1 Identities = 7/33 (21%), Positives = 22/33 (66%) Frame = -2 Query: 245 RLIDTEQNYNVLITKTNIKSHNPIVSMKCRLLL 147 R+++ + ++I+ +N+ H+P++ +C+ L+ Sbjct: 247 RIVELALFFGLVISLSNVVDHDPLLGSECKALI 279 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,722,172 Number of Sequences: 28952 Number of extensions: 119494 Number of successful extensions: 224 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -