BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L05 (366 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32805| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 2e-05 SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) 40 6e-04 SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) 40 8e-04 SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) 39 0.001 SB_7926| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_6144| Best HMM Match : SCP (HMM E-Value=4.6e-38) 38 0.002 SB_43926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) 38 0.003 SB_887| Best HMM Match : SCP (HMM E-Value=7.1e-25) 36 0.008 SB_22061| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.018 SB_50769| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) 35 0.023 SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) 35 0.023 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 34 0.041 SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) 33 0.071 SB_54432| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.16 SB_47687| Best HMM Match : SCP (HMM E-Value=1.8e-16) 32 0.16 SB_48967| Best HMM Match : SCP (HMM E-Value=8.3e-06) 31 0.22 SB_49419| Best HMM Match : SCP (HMM E-Value=5e-14) 31 0.22 SB_41526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_48716| Best HMM Match : Galactosyl_T (HMM E-Value=1.2) 29 0.87 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 29 1.2 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_57379| Best HMM Match : SCP (HMM E-Value=5.8e-19) 28 2.7 SB_8600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_8749| Best HMM Match : SCP (HMM E-Value=4.9e-16) 28 2.7 SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_8658| Best HMM Match : SCP (HMM E-Value=3e-20) 27 3.5 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 27 4.7 SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_21899| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_12270| Best HMM Match : Big_2 (HMM E-Value=8.1) 27 6.2 SB_32491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_7239| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) 26 8.1 SB_31040| Best HMM Match : PAN (HMM E-Value=0.00021) 26 8.1 >SB_32805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 48.0 bits (109), Expect = 2e-06 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = +1 Query: 67 IGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPY 210 IGH+TQ+ W +T VG V + W K Y+V Y AGN QS Y Sbjct: 169 IGHFTQIVWKSTTEVGVGVAKAIVDGWTKTYIVARYRTAGNVKGQSHY 216 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 45.2 bits (102), Expect = 2e-05 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = +1 Query: 10 KDYKYAPLKQSDFDKSKPK-----IGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNY 174 KD+ Y ++ DF+K K + H+TQ+ W ++T VG A + NKFY V Y Sbjct: 292 KDW-YDEIRDYDFNKGAGKDMWSVVLHFTQVVWRDTTEVGMATAVSLVT--NKFYTVARY 348 Query: 175 GPAGNYIDQSPYKAGKP 225 PAGN + +K P Sbjct: 349 KPAGNQGTKDDFKENVP 365 >SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) Length = 427 Score = 39.9 bits (89), Expect = 6e-04 Identities = 24/63 (38%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 4 RGKDYKYA-PLKQSDFDKSKPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGP 180 +G Y Y+ P SD D +TQ+ W ES VG Q + N+ YVV Y P Sbjct: 329 QGSHYSYSDPRLNSDTDS-------FTQLVWKESRDVGMGCAQRKGTVTNEIYVVALYYP 381 Query: 181 AGN 189 AGN Sbjct: 382 AGN 384 >SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) Length = 264 Score = 39.5 bits (88), Expect = 8e-04 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYID 198 GH+TQM W S +G +T D + YVV Y PAGN ++ Sbjct: 213 GHFTQMVWKGSKELGMGRAKTSDGRCT--YVVARYQPAGNIVN 253 >SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) Length = 1105 Score = 38.7 bits (86), Expect = 0.001 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +1 Query: 22 YAPLKQSDFDKSKPKIG--HYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 Y + + DF P+ G H+TQM W S +G + + + YVV Y P GN+ Sbjct: 615 YNEVCKYDFASGGPQPGANHFTQMVWKGSKKIGIGIAKKSEMTGTCAYVVVRYYPQGNF 673 >SB_7926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 38.7 bits (86), Expect = 0.001 Identities = 22/57 (38%), Positives = 28/57 (49%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYKAGKPSGQLV 240 GH+TQ+ W S +G A +++ Y V Y PAGN I Q P KP G V Sbjct: 63 GHFTQVVWVGSQEMGVAKAVSKN---GAHYAVARYYPAGNVIGQFPENV-KPKGSKV 115 Score = 35.5 bits (78), Expect = 0.013 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYKAGKPSG 231 GH+TQ+ W+ ST +G + +VV Y P GN + Q P +G Sbjct: 240 GHFTQVVWAGSTEMGAGKATSSS---GAHFVVARYTPPGNVMGQFPENVKPKTG 290 >SB_6144| Best HMM Match : SCP (HMM E-Value=4.6e-38) Length = 468 Score = 38.3 bits (85), Expect = 0.002 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +1 Query: 13 DYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 D Y + DF+ +P IG ++Q+ W ST +G + R + Y V Y P GNY Sbjct: 199 DSWYKDVCNYDFNAHQPVIGLFSQLVWKSSTSLGIGRSRGNYRGFACTYWVAVYKPPGNY 258 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +1 Query: 22 YAPLKQSDFDKSKPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 Y + DF+ +P IG ++Q+ W ST +G + R + Y V Y P GNY Sbjct: 2 YKDVCNYDFNTHQPVIGLFSQLVWKSSTSLGIGRSRGNYRGFACTYWVAVYKPPGNY 58 >SB_43926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.9 bits (84), Expect = 0.002 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 85 MAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPY 210 + W +T VG V + W K Y+V Y AGN I QS Y Sbjct: 1 IVWKSTTEVGVGVAKAIVGGWTKTYIVARYRTAGNAIGQSHY 42 >SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) Length = 632 Score = 37.5 bits (83), Expect = 0.003 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +1 Query: 13 DYKYAPLKQSDFDKS--KPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAG 186 D Y + DF K + GH+TQ+ W ++ G Q +D K +VV Y PAG Sbjct: 74 DKWYNEVNNYDFGKPGFQSNTGHFTQVVWRDTEEFGVGKAQGED---GKIFVVGRYRPAG 130 Query: 187 N 189 N Sbjct: 131 N 131 >SB_887| Best HMM Match : SCP (HMM E-Value=7.1e-25) Length = 147 Score = 36.3 bits (80), Expect = 0.008 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 13 DYKYAPLKQSDFDKS--KPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAG 186 D Y+ + + FDK + GH+TQ+ W + V A + D +VV Y PAG Sbjct: 77 DEWYSEISKYKFDKPGWQSGTGHFTQVVWKGTKEVAMASAEGAD---GSVFVVGRYKPAG 133 Query: 187 NYIDQ 201 N + Q Sbjct: 134 NVLSQ 138 >SB_22061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 35.5 bits (78), Expect = 0.013 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +1 Query: 1 ARGKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGP 180 A G++Y ++ + S PK +TQ+ W S +G +D Q N YVV Y P Sbjct: 799 AEGQNYSFSDPRLS------PKTDAFTQVVWKSSKKLGMGC--ARDLQTNDLYVVALYDP 850 Query: 181 AGN 189 GN Sbjct: 851 MGN 853 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.018 Identities = 19/62 (30%), Positives = 25/62 (40%) Frame = +1 Query: 16 YKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYI 195 YK + ++ GH+TQ+ W EST +G Q W Y V Y GN Sbjct: 287 YKEVCMYNFNYGGMSGATGHFTQLVWKESTLLGIGNAPGQYTGWPCTYWVARYREHGNMS 346 Query: 196 DQ 201 Q Sbjct: 347 GQ 348 >SB_50769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 34.7 bits (76), Expect = 0.023 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYKAGKPSGQLVCGN 249 GH+TQ+ W ST +G + + + + + V Y GNY A + S +V GN Sbjct: 250 GHFTQVVWKSSTKMGFGMAEGTFQNFPCVFSVARYDKPGNY-------ANRFSKNVVKGN 302 Query: 250 YD 255 +D Sbjct: 303 FD 304 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 34.7 bits (76), Expect = 0.023 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 GH+TQ+ W+ S +G T + + V Y PAGN+ Sbjct: 948 GHFTQVVWNASVELGIGKATTTKNGTSCTFYVARYKPAGNH 988 >SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) Length = 1189 Score = 34.7 bits (76), Expect = 0.023 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 22 YAPLKQSDFDK--SKPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGN 189 Y +K DF S P H++Q+ W + +G V + Q + N F++V Y P GN Sbjct: 419 YQEVKNYDFKNPHSDPSTSHFSQLVWKGTKKLG--VGEAQSKSGN-FFLVARYHPKGN 473 >SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) Length = 387 Score = 34.7 bits (76), Expect = 0.023 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +1 Query: 82 QMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYKAG 219 ++ W ++ +G A+ + + W Y+V Y P GNY + + G Sbjct: 338 RIVWKDTRRLGVAIARIKRGLWYSTYIVARYSPPGNYNGEFTQQVG 383 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 33.9 bits (74), Expect = 0.041 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 64 KIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYKAGKPSGQ 234 K GH+TQ+ W + +G A + D +VV Y P GN + + + GQ Sbjct: 3727 KCGHFTQLVWRGTKEIGVAKRVSAD---GTQFVVARYHPPGNVLGEFKENIKRAKGQ 3780 >SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) Length = 191 Score = 33.1 bits (72), Expect = 0.071 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +1 Query: 64 KIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 + GH+T + W ++ +G ++ + N +VV Y GN+ Sbjct: 115 RTGHFTALVWKDTKELGIGTATSKKGRMNCLWVVARYRSGGNF 157 >SB_54432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.9 bits (69), Expect = 0.16 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +1 Query: 73 HYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYKAGKPSGQLVCGNY 252 H+TQ+ W ST +G + YVV Y GN+ D+ Y A G +Y Sbjct: 121 HFTQIVWKASTELGFG----SAKGTKCTYVVGRYKKRGNFGDEKDYDANVKKGSFDATSY 176 >SB_47687| Best HMM Match : SCP (HMM E-Value=1.8e-16) Length = 600 Score = 31.9 bits (69), Expect = 0.16 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 76 YTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGN 189 +TQ+ W + G ++ D YVV Y PAGN Sbjct: 523 FTQVVWQNTKEFGVGCARSADNSSGPVYVVALYKPAGN 560 >SB_48967| Best HMM Match : SCP (HMM E-Value=8.3e-06) Length = 139 Score = 31.5 bits (68), Expect = 0.22 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGN 189 GH+TQ+ W ST +G + Y V Y AGN Sbjct: 78 GHFTQVVWKTSTELGFGSASAEQGGMKCTYYVGRYKEAGN 117 >SB_49419| Best HMM Match : SCP (HMM E-Value=5e-14) Length = 555 Score = 31.5 bits (68), Expect = 0.22 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGN 189 GH+TQ+ W ST +G + Y V Y AGN Sbjct: 491 GHFTQVVWKGSTELGVGKASAEQHGMICTYHVARYKDAGN 530 >SB_41526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 30.3 bits (65), Expect = 0.50 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 7 GKDYKYAPLKQSDFDKS--KPKIGHYTQMAWSESTHVG 114 G D Y DF P GH+TQ+ W ST +G Sbjct: 11 GVDLWYKESNNYDFQSPGYSPATGHFTQLVWKASTRMG 48 >SB_48716| Best HMM Match : Galactosyl_T (HMM E-Value=1.2) Length = 323 Score = 29.5 bits (63), Expect = 0.87 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 95 LSPLTSDVLFCKLKIDSGINSTLYATTGRLVITSISL 205 LSP FC + + GI S+L+A L IT++++ Sbjct: 276 LSPSVKPASFCSIAVFYGITSSLFAGVSLLSITAVAV 312 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 29.1 bits (62), Expect = 1.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVV 165 GH+TQ+ W EST +G ++ + Y V Sbjct: 163 GHFTQVVWKESTELGFGSASAEEDKMKCTYYV 194 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +1 Query: 67 IGHYTQMAWSESTHVGCAVLQTQDRQWNKF---YVVCNYGPAGNYIDQ 201 IGH+ + W T +GC + N + YV +Y P N D+ Sbjct: 234 IGHFQAVVWKGETKLGCGLTFKPGDPKNGYYGTYVTAHYAPPSNTGDK 281 >SB_57379| Best HMM Match : SCP (HMM E-Value=5.8e-19) Length = 168 Score = 27.9 bits (59), Expect = 2.7 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 73 HYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQ 201 H+TQ+ W + +G + W +V Y PAGN+ Q Sbjct: 127 HFTQVVWKATRRIGVGI----SGNW----IVVRYSPAGNWAGQ 161 >SB_8600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 27.9 bits (59), Expect = 2.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 70 GHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 GH+TQ+ W ST +G Q + V Y AGN+ Sbjct: 300 GHFTQVVWKGSTKLGYGKANGQYSGAECEFHVGRYKAAGNF 340 >SB_8749| Best HMM Match : SCP (HMM E-Value=4.9e-16) Length = 369 Score = 27.9 bits (59), Expect = 2.7 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +1 Query: 22 YAPLKQSDFDKS--KPKIGHYTQMAWSESTHVG 114 Y +K+ DF+ GH+TQ+ W ST +G Sbjct: 308 YNEVKKYDFNSPGFSDPTGHFTQVVWKASTELG 340 >SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.9 bits (59), Expect = 2.7 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 6/42 (14%) Frame = -3 Query: 208 RETDRCNYQPARSCIQRR-IYSTVDLEFA-----KQHIRREW 101 R++D C Y+ R C+ RR YS L FA KQ +R +W Sbjct: 27 RQSDECLYRFTRLCLLRRGGYSRESLAFAGRVEIKQTLRGDW 68 >SB_8658| Best HMM Match : SCP (HMM E-Value=3e-20) Length = 273 Score = 27.5 bits (58), Expect = 3.5 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = +1 Query: 13 DYKYAPLKQSDFDKS--KPKIGHYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAG 186 D Y K FD K G++TQ+ W S VG + VV + PAG Sbjct: 125 DKWYDGSKNYSFDNPGFKRDAGNFTQLVWKSSREVGIGKAISSS---GNAVVVARFRPAG 181 Query: 187 N 189 N Sbjct: 182 N 182 >SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1444 Score = 27.1 bits (57), Expect = 4.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 79 TQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNYIDQSPYK 213 T+M W+ S +G A ++ + YVV Y P GN S Y+ Sbjct: 1102 TRMVWNASRQLGGA--WARNTPSGRSYVVFKYNPLGNSGGSSEYE 1144 >SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 26.6 bits (56), Expect = 6.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 226 WVCLLCRETDRCNYQPARSC 167 WVC +CR+T R N + + C Sbjct: 157 WVCDVCRQTSRINERFSHHC 176 >SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -1 Query: 144 LSILSLQNSTSDVSGLRPCHLCVMAYFGFRLVEVTLFQGSIFVIF 10 L+++ N+T ++ + + + G RL T+F G VIF Sbjct: 98 LALIDFLNATVNLPVFTAAGVLQLGHMGGRLASATIFAGQTLVIF 142 >SB_21899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 26.6 bits (56), Expect = 6.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 73 HYTQMAWSESTHVGCAVLQTQDRQWNKFYVVCNYGPAGNY 192 H+TQ+ W +T VG A + ++V Y P GN+ Sbjct: 125 HFTQIVWKSTTKVGVAKVGV--------WLVARYDPPGNW 156 >SB_12270| Best HMM Match : Big_2 (HMM E-Value=8.1) Length = 112 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +2 Query: 8 VKITNMLP*NRVTSTSLN 61 VK+TN++P +RVTS ++N Sbjct: 47 VKLTNIMPSSRVTSVTIN 64 >SB_32491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 77 THRWHGLSPLTSDVLFCKLKIDSG 148 TH WHGLS +L C L G Sbjct: 130 THGWHGLSLQLDAILVCTLTSSCG 153 >SB_7239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 77 THRWHGLSPLTSDVLFCKLKIDSG 148 TH WHGLS +L C L G Sbjct: 20 THGWHGLSLQLDAILVCTLTSSCG 43 >SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) Length = 2442 Score = 26.2 bits (55), Expect = 8.1 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -1 Query: 285 STPLAVGTFAVVVAAY*LSAGFACFVGRLIDVITSRPVVAYNVEF 151 STP A G A A S+ + FV V+TS P A F Sbjct: 2287 STPFAFGAPATAAAVSTASSAPSAFVFGATPVVTSTPAAASGFSF 2331 >SB_31040| Best HMM Match : PAN (HMM E-Value=0.00021) Length = 661 Score = 26.2 bits (55), Expect = 8.1 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 56 LNPK*AITHRWHGLSPLTSDVLFCKLKIDSGINSTLYA 169 LNP+ A + W ++P + +FC + DSG + +Y+ Sbjct: 263 LNPRAASGNYWISVNPPNAMRVFCDMTTDSGGWTLVYS 300 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,531,224 Number of Sequences: 59808 Number of extensions: 237939 Number of successful extensions: 700 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 582596255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -