BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_L03 (289 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 20 6.1 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 20 6.1 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 19 8.0 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 19.8 bits (39), Expect = 6.1 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 6 GEERRLQSPKKEDCNRRRKKTAIAEERRLQSPKKE 110 GE++ PK ED + E+++ + KE Sbjct: 237 GEDKDKDKPKIEDVGEDEDEDTKKEDKKKKKTIKE 271 Score = 19.4 bits (38), Expect = 8.0 Identities = 12/59 (20%), Positives = 23/59 (38%) Frame = +2 Query: 101 EERKLQSPKNENCNRRRKKTAIAEERRPQSPKKEDCNRRRKKTAIAEERRLQSPKKEDL 277 EE K++ ++ + E+ + +D KK E++ PK ED+ Sbjct: 192 EEHKIKEIVKKHSQFIGYPIKLVVEKEREKELSDDEAEEEKKEEEGEDKDKDKPKIEDV 250 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 19.8 bits (39), Expect = 6.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 93 QSPKKENCNRRRMKTAIAEERRLQSPKKEDRNR 191 +S ++EN RR++TA + L+ K+ N+ Sbjct: 126 KSSQQENGLPRRLRTAYTNTQLLELEKEFHFNK 158 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 19.4 bits (38), Expect = 8.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 20 TAIAEERRLQSPKKEDCNRRRKKIAIAEERKL 115 T +++ L+SP KI AE+RKL Sbjct: 242 TTCNKKQHLESPSALQAKVDPLKIPEAEKRKL 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,398 Number of Sequences: 336 Number of extensions: 1549 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 48 effective length of database: 106,457 effective search space used: 5003479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -