BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K24 (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g04620.2 68418.m00464 aminotransferase class I and II family ... 77 7e-15 At4g36480.1 68417.m05180 aminotransferase class I and II family ... 63 1e-10 At5g23670.1 68418.m02775 serine C-palmitoyltransferase (LCB2) id... 62 2e-10 At3g48780.1 68416.m05327 serine C-palmitoyltransferase, putative... 62 2e-10 At5g04620.1 68418.m00465 aminotransferase class I and II family ... 44 6e-05 At1g16960.1 68414.m02059 expressed protein 31 0.47 At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase I... 28 3.3 At3g20350.1 68416.m02578 expressed protein 28 3.3 At1g50660.1 68414.m05696 expressed protein similar to liver stag... 28 3.3 At3g16430.2 68416.m02088 jacalin lectin family protein similar t... 28 4.4 At3g16430.1 68416.m02087 jacalin lectin family protein similar t... 28 4.4 At2g39310.1 68415.m04826 jacalin lectin family protein similar t... 27 5.8 At4g26000.1 68417.m03745 KH domain-containing protein single-str... 27 7.7 At2g20060.1 68415.m02344 ribosomal protein L4 family protein con... 27 7.7 >At5g04620.2 68418.m00464 aminotransferase class I and II family protein similar to 8-amino-7-oxononanoate synthase, Bacillus sphaericus, PIR:JQ0512 [SP|P22806], Bacillus subtilis [SP|P53556]; contains Pfam protile PF00155 aminotransferase, classes I and II Length = 476 Score = 77.0 bits (181), Expect = 7e-15 Identities = 48/120 (40%), Positives = 63/120 (52%), Gaps = 14/120 (11%) Frame = +3 Query: 207 QGSDGEFLNFCANNYLGLSNHPEVVEAAREGLKKYGAGLSSVRFICGTQTIHKELEHRLA 386 +G + L F N+YLGLS+HP + AA +K+YG G ICG T H+ LE LA Sbjct: 98 KGRFKKLLLFSGNDYLGLSSHPTISNAAANAVKEYGMGPKGSALICGYTTYHRLLESSLA 157 Query: 387 QFHGREDAILYGSCFDAN------AGLFESMLTPED--------AVFSDALNQASIIDGI 524 Q +ED ++ + F AN G S+L A+FSDALN ASIIDG+ Sbjct: 158 QLKKKEDCLVCPTGFAANMAAMVAIGSVASLLAASGKPLKNEKVAIFSDALNHASIIDGV 217 >At4g36480.1 68417.m05180 aminotransferase class I and II family protein similar to Serine palmitoyltransferase 1 (EC 2.3.1.50) from Homo sapiens [SP|O15269], Mus musculus [SP|O35704], Cricetulus griseus [SP|O54695] Length = 482 Score = 62.9 bits (146), Expect = 1e-10 Identities = 35/88 (39%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = +3 Query: 159 KHER-VLTSPQDTKVKVQGSDGEFLNFCANNYLGLSNHPEVVEAAREGLKKYGAGLSSVR 335 KHE VL S V G D +NF + NYLGL H +++E+ L+KYG G R Sbjct: 90 KHEPPVLESAAGPHTTVNGKD--VVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPR 147 Query: 336 FICGTQTIHKELEHRLAQFHGREDAILY 419 GT +H + E R+++F G D+ILY Sbjct: 148 GFYGTIDVHLDCETRISKFLGTPDSILY 175 >At5g23670.1 68418.m02775 serine C-palmitoyltransferase (LCB2) identical to serine palmitoyltransferase [Arabidopsis thaliana] GI:9309380; similar to serine palmitoyltransferase from Solanum tuberosum [GI:4995890], Homo sapiens [SP|O15270], Mus musculus [SP|P97363]; contains Pfam profile PF00155: aminotransferase, classes I and II Length = 489 Score = 62.5 bits (145), Expect = 2e-10 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 1/99 (1%) Frame = +3 Query: 228 LNFCANNYLGLSNHPEV-VEAAREGLKKYGAGLSSVRFICGTQTIHKELEHRLAQFHGRE 404 LN + NYLG + E E LKK+ A S R GT ++H ELE + +F G+ Sbjct: 103 LNLGSYNYLGFGSFDEYCTPRVIESLKKFSASTCSSRVDAGTTSVHAELEECVTRFVGKP 162 Query: 405 DAILYGSCFDANAGLFESMLTPEDAVFSDALNQASIIDG 521 A+++G + N+ + ++ + SD+LN +SI++G Sbjct: 163 AAVVFGMGYATNSAIIPVLIGKGGLIISDSLNHSSIVNG 201 >At3g48780.1 68416.m05327 serine C-palmitoyltransferase, putative similar to serine palmitoyltransferase from Solanum tuberosum [GI:4995890], Homo sapiens [SP|O15270], Mus musculus [SP|P97363] Length = 489 Score = 62.1 bits (144), Expect = 2e-10 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 1/99 (1%) Frame = +3 Query: 228 LNFCANNYLGLSNHPEV-VEAAREGLKKYGAGLSSVRFICGTQTIHKELEHRLAQFHGRE 404 LN + NYLG + E E LKK+ A S R GT ++H ELE +A++ G+ Sbjct: 103 LNLGSYNYLGFGSFDEYCTPRVIESLKKFSASTCSSRVDAGTTSVHAELEDCVAKYVGQP 162 Query: 405 DAILYGSCFDANAGLFESMLTPEDAVFSDALNQASIIDG 521 A+++G + N+ + ++ + SD+LN SI++G Sbjct: 163 AAVIFGMGYATNSAIIPVLIGKGGLIISDSLNHTSIVNG 201 >At5g04620.1 68418.m00465 aminotransferase class I and II family protein similar to 8-amino-7-oxononanoate synthase, Bacillus sphaericus, PIR:JQ0512 [SP|P22806], Bacillus subtilis [SP|P53556]; contains Pfam protile PF00155 aminotransferase, classes I and II Length = 343 Score = 44.0 bits (99), Expect = 6e-05 Identities = 31/76 (40%), Positives = 39/76 (51%), Gaps = 14/76 (18%) Frame = +3 Query: 339 ICGTQTIHKELEHRLAQFHGREDAILYGSCFDAN------AGLFESMLTPED-------- 476 ICG T H+ LE LAQ +ED ++ + F AN G S+L Sbjct: 9 ICGYTTYHRLLESSLAQLKKKEDCLVCPTGFAANMAAMVAIGSVASLLAASGKPLKNEKV 68 Query: 477 AVFSDALNQASIIDGI 524 A+FSDALN ASIIDG+ Sbjct: 69 AIFSDALNHASIIDGV 84 >At1g16960.1 68414.m02059 expressed protein Length = 114 Score = 31.1 bits (67), Expect = 0.47 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +3 Query: 93 GVAKLREVLEDRLQEIKRAKTWKHERVLTSPQDTKVK 203 G + R + E + ++I+R KTWKH + ++ + T+++ Sbjct: 2 GCSSSRTIAEGKKEKIRRPKTWKHPQPISRDELTQMR 38 >At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase IV GI:9651815 from [Arabidopsis thaliana]; identical to cDNA DNA ligase IV, GI:9651814 Length = 1219 Score = 28.3 bits (60), Expect = 3.3 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +3 Query: 216 DGEFL--NFCANNYLGLSNHPEVVEAAREGL---KKYGAGLSSVRFICGTQTIHKELEHR 380 DGE L + N + ++ E+ +AAREGL K+ V ++ T IH+ L+ R Sbjct: 301 DGEMLVWDTSLNRFAEFGSNQEIAKAAREGLDSHKQLCYVAFDVLYVGDTSVIHQSLKER 360 >At3g20350.1 68416.m02578 expressed protein Length = 673 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 105 LREVLEDRLQEIKRAKTWKHERVLTSPQDTKVKVQ 209 LRE ++D + ++ A+ W+ ERV D KV ++ Sbjct: 350 LREEVDDERRMLQMAEVWREERVQMKLIDAKVTLE 384 >At1g50660.1 68414.m05696 expressed protein similar to liver stage antigen-1 (GI:510184) [Plasmodium falciparum]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum]; similar to liver stage antigen (GI:9916) [Plasmodium falciparum]; similar to Kinesin-like protein KLPA (Swiss-Prot:P28739) [Emericella nidulans] Length = 725 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 105 LREVLEDRLQEIKRAKTWKHERVLTSPQDTKVKVQ 209 LRE ++D + ++ A+ W+ ERV D KV ++ Sbjct: 373 LREEVDDERRMLQMAEVWREERVQMKLIDAKVALE 407 >At3g16430.2 68416.m02088 jacalin lectin family protein similar to myrosinase binding protein [Brassica napus] GI:1711296; contains Pfam profile PF01419 jacalin-like lectin domain Length = 296 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 345 GTQTIHKELEHRLAQFHGREDAILY 419 GT KE H++ FHGR DA+L+ Sbjct: 261 GTAFELKEEGHKIVGFHGRADALLH 285 >At3g16430.1 68416.m02087 jacalin lectin family protein similar to myrosinase binding protein [Brassica napus] GI:1711296; contains Pfam profile PF01419 jacalin-like lectin domain Length = 296 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 345 GTQTIHKELEHRLAQFHGREDAILY 419 GT KE H++ FHGR DA+L+ Sbjct: 261 GTAFELKEEGHKIVGFHGRADALLH 285 >At2g39310.1 68415.m04826 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 458 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 345 GTQTIHKELEHRLAQFHGREDAILYGSCFDANAGLFESMLTPEDAVFSDAL 497 G + + ++ HRL FHG+EDA + DA F + TP + S L Sbjct: 269 GKKFVLEQKGHRLVGFHGKEDAAI-----DALGAYFGPVPTPTPLIPSKKL 314 >At4g26000.1 68417.m03745 KH domain-containing protein single-stranded nucleic acid-binding protein CBP - mouse, PIR2:S78515 Length = 495 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 520 PSMIDAWLRASENTASSGVSIDSKRPALASKHDP 419 P ++ R SGVSI S+ P L+++H P Sbjct: 295 PLFLERDSRVDSRVQPSGVSIYSQDPVLSARHSP 328 >At2g20060.1 68415.m02344 ribosomal protein L4 family protein contains Pfam profile PF00573: ribosomal protein L4/L1 family Length = 300 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 417 YGSCFDANAGLFESMLTPEDAVFSDALNQASII 515 YG +N L S+LTP+D+ SD L + +++ Sbjct: 45 YGMALLSNRKLSTSILTPDDSFPSDLLTKKTVL 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,512,624 Number of Sequences: 28952 Number of extensions: 203141 Number of successful extensions: 710 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -