BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K22 (347 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.78 SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_28034| Best HMM Match : zf-CCHC (HMM E-Value=0.022) 28 2.4 SB_23091| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) 28 2.4 SB_57101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_31464| Best HMM Match : Lyase_1 (HMM E-Value=2.2e-32) 27 3.2 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 27 3.2 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_44501| Best HMM Match : Adap_comp_sub (HMM E-Value=2.39622e-43) 27 4.2 SB_13836| Best HMM Match : HEAT (HMM E-Value=0.39) 27 4.2 SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) 27 4.2 SB_5326| Best HMM Match : HEAT (HMM E-Value=3.1e-05) 27 4.2 SB_41183| Best HMM Match : Sec_GG (HMM E-Value=4.9) 27 5.5 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 27 5.5 SB_49195| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.3 SB_45390| Best HMM Match : Glyco_transf_10 (HMM E-Value=2.5e-20) 26 7.3 SB_40408| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.3 SB_32209| Best HMM Match : Peptidase_M1 (HMM E-Value=0) 26 7.3 SB_22415| Best HMM Match : TT_ORF2 (HMM E-Value=3.7) 26 7.3 SB_43579| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.3 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 26 7.3 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 26 9.7 SB_10714| Best HMM Match : Retrotrans_gag (HMM E-Value=5.4e-09) 26 9.7 SB_57883| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-10) 26 9.7 SB_57118| Best HMM Match : TMS_TDE (HMM E-Value=0) 26 9.7 >SB_55846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 0.78 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ S R +++V LQ P A Sbjct: 30 LCQRLKLPKSEWLHQFVRSLREPLKEYVVLQSPADFETA 68 >SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1958 Score = 28.3 bits (60), Expect = 1.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 1301 LCQRLKLPKSEWLHQFVCGLRGPLKEYVLLQSPADFETA 1339 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 27.9 bits (59), Expect = 2.4 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = -2 Query: 202 PRTSWRSQQHVRLQGPRPLSRAAPMRGPSHGSDD--YSPSISLGSTSQRIHQRRSAF 38 PRT + +GP P A P R P DD +SP + S R +R F Sbjct: 459 PRTPPGDPTYEHTRGPPPERHARPPRTPPSDHDDRPFSPIEQEANRSNRFSERDGEF 515 >SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 288 LCQRLKLPKSEWLHQFVRGLRGPLKEYVVLQSPADFETA 326 >SB_28034| Best HMM Match : zf-CCHC (HMM E-Value=0.022) Length = 222 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 23 LCQRLKLPKSEWLHQFVRGLRGPLKEYVVLQSPADFETA 61 >SB_23091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 82 LCQRLKLPKSEWLHQFVRGLRGPLKEYVILQSPADFETA 120 >SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) Length = 882 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 186 LCQRLKLPKSEWLHQFVRGLRGPLKEYVVLQSPADFETA 224 >SB_57101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 68 LCQRLKLPKSEWLHQFVRGLRGPLKEYVVLQSPADFETA 106 >SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 27.9 bits (59), Expect = 2.4 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGP 155 LC R LP+ EWLH+ R +++V LQ P Sbjct: 77 LCQRLKLPNSEWLHQFVRGLRGPLKEYVVLQSP 109 >SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 670 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 247 LCSRRTLPSCEWLHRPRTSWRS--QQHVRLQGPRPLSRA 137 LC R LP EWLH+ R +++V LQ P A Sbjct: 84 LCQRLKLPKSEWLHQFVRGLRGPLKEYVVLQSPADFETA 122 >SB_31464| Best HMM Match : Lyase_1 (HMM E-Value=2.2e-32) Length = 306 Score = 27.5 bits (58), Expect = 3.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 129 CVVLRMDQTITRRAFPWAVQVNEFTSVVLHFVYLSSTQIATSC 1 C VL D TI A +Q+N F V++H + S +A C Sbjct: 191 CQVLGNDTTIAFAASQGHLQLNVFKPVIIHNLLQSVRLLADGC 233 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 27.5 bits (58), Expect = 3.2 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = -2 Query: 238 RRTLPSCEWLHRPRTSWRSQQHVRLQGPRPLSRAAPMRGPSHGSDDYSPSISLGSTSQRI 59 + T S EW +PR +WRS + SR A M P D S++ G+ S Sbjct: 440 QNTESSDEW--KPRHAWRSAGSPAMADTIGRSRHAGMSIPIDTMDQDLQSVTSGTQSHMT 497 Query: 58 HQRR---SAFCV 32 H+ S +CV Sbjct: 498 HRAEELSSEWCV 509 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 27.1 bits (57), Expect = 4.2 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = -2 Query: 223 SCEWLHRPRTSWRSQQHVRLQGPR--PLSRAAPM-RGPSHGSDDYSPSISLGSTSQRIHQ 53 S +W R R +GP+ PL A R PS G DD P G +R HQ Sbjct: 504 SNDWDRRSLDKMSRGPQYRRRGPQTPPLEDFAQFERSPSKGMDDEGPRKRRGQYRKRDHQ 563 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 27.1 bits (57), Expect = 4.2 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -1 Query: 269 PSFLVSLTMQSSDSPILRMAPQTTYILEESAARPVAGSTSAIT 141 P V+++ Q +P + +AP+TT + E + A T T Sbjct: 396 PEISVTISTQPKKAPGITVAPETTVVPETTVASETTAETHQTT 438 >SB_44501| Best HMM Match : Adap_comp_sub (HMM E-Value=2.39622e-43) Length = 822 Score = 27.1 bits (57), Expect = 4.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -3 Query: 216 NGSTDHVHLGGVSSTSGCRVHVRYHELHRCVVLRMDQTITRR 91 NGS D +H G SS + R+ R R M+ T +R Sbjct: 94 NGSIDKIHAGKTSSEASVRLAQRVETQPRITTNSMESTNMKR 135 >SB_13836| Best HMM Match : HEAT (HMM E-Value=0.39) Length = 400 Score = 27.1 bits (57), Expect = 4.2 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 124 GPSHGSDDYS-PSISLGSTSQRIHQRRSAFCVSKLHTDR 11 G +HG + + PS LGS+ HQR S VSKL TD+ Sbjct: 260 GVNHGWNSHRRPSSQLGSSK---HQRISIRAVSKLLTDQ 295 >SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) Length = 3445 Score = 27.1 bits (57), Expect = 4.2 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 242 QSSDSPILRMAPQTTYILEESAA--RPVAGSTSAITSCTDA 126 +++D+P + MAP+TT +E + A A T+ TDA Sbjct: 925 ETTDAPAITMAPETTDAIETTMATETTAAQETTVAPEITDA 965 >SB_5326| Best HMM Match : HEAT (HMM E-Value=3.1e-05) Length = 538 Score = 27.1 bits (57), Expect = 4.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 133 PMRGPSHGSDDYSPSISLGSTSQRIHQRR 47 P R PSH +D Y+P + G +Q H R Sbjct: 240 PDRMPSHFNDTYTPIAAAGGQAQVAHLAR 268 >SB_41183| Best HMM Match : Sec_GG (HMM E-Value=4.9) Length = 198 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 144 DSGRGPCNRTCC*LLQDVRGLWSHSQDGRVRRLH 245 D GRGPC+R C L+ + GR+ +H Sbjct: 138 DEGRGPCSRRRCVLISEDNVTRCKWPLGRIEAVH 171 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 26.6 bits (56), Expect = 5.5 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -1 Query: 254 SLTMQSSDSPILRMAPQTTYILEESAA 174 ++T +++ +P +AP+TT +LE SAA Sbjct: 6 TVTAETTAAPETTVAPETTAVLETSAA 32 >SB_49195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 26.2 bits (55), Expect = 7.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 145 SRAAPMRGPSHGSDDYSPSISLGSTS 68 SRA +R PSHGS D S S ++ S Sbjct: 32 SRAPSLRIPSHGSSDDSHSKAINDIS 57 >SB_45390| Best HMM Match : Glyco_transf_10 (HMM E-Value=2.5e-20) Length = 435 Score = 26.2 bits (55), Expect = 7.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 144 HELHRCVVLRMDQTITRRAFPWAVQVNEF 58 H HR VVL+ R+ +PW ++F Sbjct: 87 HSHHRKVVLQYTAVFDRKPWPWMENTDQF 115 >SB_40408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 26.2 bits (55), Expect = 7.3 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 34 HKMQNDAGEFVDLYCPRKCSAS-NRLIHAKDHASVQLVIADVDPATGRAADSSKMYVVC 207 HK+ AGE C ++C S RLI A ++ + + VI +D R + +K + C Sbjct: 22 HKLGEKAGEHQASKCHQECMISGQRLIQAIENPA-KSVITVLDEEKRRNIERNKHIIKC 79 >SB_32209| Best HMM Match : Peptidase_M1 (HMM E-Value=0) Length = 1240 Score = 26.2 bits (55), Expect = 7.3 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -2 Query: 136 APMRGPSHGSDDYSPSISLG----STSQRIHQRRSAFCVSKLHTDRDL 5 A M+G HGS D++ +S ST Q++ + ++CV + + D+ Sbjct: 1066 ALMKGYGHGSFDFARLVSRTTTHFSTPQKLKEASRSYCVENILKNLDI 1113 >SB_22415| Best HMM Match : TT_ORF2 (HMM E-Value=3.7) Length = 483 Score = 26.2 bits (55), Expect = 7.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 205 RPRTSWRSQQHVRLQGPRPLSRAAPMRGPSH 113 RPR ++ S + RL P PL + P P H Sbjct: 94 RPRFTFFSPKDNRLPSPPPLLKQLPFFSPKH 124 >SB_43579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 26.2 bits (55), Expect = 7.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 103 RLIHAKDHASVQLVIADVDPATGR 174 R+ H +HA Q++ A +DP TG+ Sbjct: 44 RVHHGINHAKSQILTAKLDPLTGK 67 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 26.2 bits (55), Expect = 7.3 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 227 PILRMAPQTTYILEESAARPVAGSTSAITSCTD 129 P + QT+Y ES P+ TSA SC D Sbjct: 436 PNMTWMNQTSYKCSESFINPLTNRTSAKCSCQD 468 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 25.8 bits (54), Expect = 9.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -3 Query: 213 GSTDHVHLGGVSSTSGCRVHVRYHELHRCVV 121 G+ +++ GG+SS ++H Y LH +V Sbjct: 999 GTENNIEGGGISSQDESQLHAFYRGLHNLLV 1029 >SB_10714| Best HMM Match : Retrotrans_gag (HMM E-Value=5.4e-09) Length = 132 Score = 25.8 bits (54), Expect = 9.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 247 LCSRRTLPSCEWLHR 203 LC R LP EWLH+ Sbjct: 107 LCQRLKLPKSEWLHQ 121 >SB_57883| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-10) Length = 325 Score = 25.8 bits (54), Expect = 9.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 105 TITRRAFPWAVQVNEFTSVVLHFVY 31 ++ R AFPWAV + F S + +Y Sbjct: 250 SLKRHAFPWAVTLTFFNSCLNPVIY 274 >SB_57118| Best HMM Match : TMS_TDE (HMM E-Value=0) Length = 1457 Score = 25.8 bits (54), Expect = 9.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 199 RTSWRSQQHVRLQGPRPLSRAAPMRGPSH 113 R + RSQ R + P P++R P+R H Sbjct: 568 RPATRSQIRQRAKSPPPVARKPPIRAKQH 596 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,418,119 Number of Sequences: 59808 Number of extensions: 242282 Number of successful extensions: 4229 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 4113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4226 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 523129866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -