BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K19 (471 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40639| Best HMM Match : CAP_GLY (HMM E-Value=0) 44 5e-05 SB_20015| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 8e-04 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 38 0.006 SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.052 SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12) 33 0.16 SB_17550| Best HMM Match : WW (HMM E-Value=0.0012) 32 0.21 SB_25593| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_29018| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.64 SB_52413| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_28746| Best HMM Match : UPF0193 (HMM E-Value=0.31) 30 0.84 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 30 1.1 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_44622| Best HMM Match : dsrm (HMM E-Value=3.1e-16) 29 1.5 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 1.5 SB_51384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_369| Best HMM Match : Pox_A32 (HMM E-Value=0.2) 29 1.9 SB_33079| Best HMM Match : FYVE (HMM E-Value=1.1e-29) 29 2.6 SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) 28 3.4 SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) 28 3.4 SB_8941| Best HMM Match : VWA (HMM E-Value=0) 28 4.5 SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_28990| Best HMM Match : YABBY (HMM E-Value=0.45) 28 4.5 SB_58745| Best HMM Match : rve (HMM E-Value=0.0023) 27 5.9 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_44641| Best HMM Match : rve (HMM E-Value=1.9e-19) 27 5.9 SB_40000| Best HMM Match : Pox_A32 (HMM E-Value=0.053) 27 5.9 SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 27 5.9 SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) 27 5.9 SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) 27 5.9 SB_2035| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 27 5.9 SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) 27 5.9 SB_39424| Best HMM Match : Pox_A32 (HMM E-Value=0.033) 27 5.9 SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) 27 5.9 SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) 27 5.9 SB_54102| Best HMM Match : Pox_A32 (HMM E-Value=2.6) 27 7.8 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 7.8 SB_57471| Best HMM Match : TatC (HMM E-Value=0.27) 27 7.8 SB_52465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) 27 7.8 SB_29566| Best HMM Match : HypA (HMM E-Value=0.38) 27 7.8 SB_18915| Best HMM Match : Pox_A32 (HMM E-Value=0.052) 27 7.8 SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) 27 7.8 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_40639| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 709 Score = 44.4 bits (100), Expect = 5e-05 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 23 ENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPEAPAE 145 E +A LP+GW + SR G YY NT T +S+W+ P P + Sbjct: 78 EFEANLPEGWIISKSRQHGRMYYFNTETAESRWQHPLIPED 118 >SB_20015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 2 HEARMSN-ENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPEA 136 H +R + E PLP GWE RT S G +YY++ T+ + W+RP A Sbjct: 402 HNSRTTAWERPQPLPHGWERRTD-SRGRTYYVDHNTRTTTWQRPTA 446 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +2 Query: 8 ARMSNENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPE 133 AR N+ PLP GWE R G YY++ ++ + WERP+ Sbjct: 373 ARPLTGNEEPLPPGWEQRVD-PHGRIYYVDHNSRTTAWERPQ 413 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 5 EARMSNENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 +A N PLP GWE R + G Y++N T+ +QWE P Sbjct: 481 DAERDNGPLGPLPAGWEKRV-ETNGRVYFVNHNTRTTQWEDP 521 Score = 31.5 bits (68), Expect = 0.36 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 29 DAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 D PLP GWEMR + + G+ Y+++ T+ + + P Sbjct: 530 DKPLPQGWEMRYT-NEGIPYFVDHNTRTTTFTDP 562 >SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 40.3 bits (90), Expect = 8e-04 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +2 Query: 8 ARMSNENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPEA 136 AR S E PLP+GWE R + G ++Y++ T+ + W RP + Sbjct: 174 ARSSAEQPPPLPEGWEERQD-ANGRTFYIDHTTRTTTWVRPSS 215 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 26 NDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPE 133 N+ LPDGW M TG YY + + +QWERP+ Sbjct: 1274 NEYELPDGW-MEVESGTGSKYYWHVSSGTTQWERPQ 1308 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +2 Query: 5 EARMSNENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPEAPAE 145 E + ++ P GW R +Y N TKKSQWE P AE Sbjct: 408 EEHIKEYEESASPPGWSCHWDRKYKQYFYTNLETKKSQWEFPTDDAE 454 >SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 34.3 bits (75), Expect = 0.052 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 35 PLPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 PLP+GWEM ++G ++++ T+ + W P Sbjct: 7 PLPNGWEMTVDPNSGRPFFIDHNTRTTTWTDP 38 >SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1668 Score = 33.1 bits (72), Expect = 0.12 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 29 DAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 + PLP GWE G YY++ Y+ ++ W P Sbjct: 8 EVPLPVGWEEARDTRDGRVYYIDHYSHRTTWIDP 41 >SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12) Length = 893 Score = 32.7 bits (71), Expect = 0.16 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 32 APLPDGWEMRTSRSTGMSYYLNTYTKKSQWERPE 133 A LP GWE ++TG +Y + T+ + W P+ Sbjct: 487 AGLPHGWEKAVDQTTGRIFYRDHNTQTTHWNPPQ 520 >SB_17550| Best HMM Match : WW (HMM E-Value=0.0012) Length = 677 Score = 32.3 bits (70), Expect = 0.21 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 35 PLPDGWEMRTSRS-TGMSYYLNTYTKKSQWERP-EAPAEL-TEIRCSHILVKHV 187 PLP+GW M+ S S G Y+ + + + W+ P + ++ EI CS H+ Sbjct: 12 PLPNGWIMKESSSRPGRKYFFHKMSGMTSWKHPLDLSHKIPAEISCSKTRACHI 65 >SB_25593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 31.9 bits (69), Expect = 0.28 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 348 PRLADEQ-SEYLVAISTKVISLATICLRYFFNISRASSLL 232 P L+DE+ EY+ A+ TK S CLR+ + I+ LL Sbjct: 330 PELSDEKMKEYMKALKTKKFSKLEFCLRHPYTIALVEGLL 369 >SB_29018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 30.7 bits (66), Expect = 0.64 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 38 LPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 LP W+ T G YY +T T+++QW+ P Sbjct: 848 LPPNWKTATDPQ-GKIYYYHTLTRRTQWDPP 877 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 30.7 bits (66), Expect = 0.64 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -1 Query: 459 YPESVSIGLLSCPIGNVKASSSNAFCI-CPFPNIPKSPPRLADEQSEYLVAISTKVISLA 283 Y ++VS +CP G K S+ NA C+ CP + P++ S Y A + K+ + Sbjct: 139 YQDTVS-ACTACPRGTYKPSAGNATCVACPRNSAPEADRTSCRCTSGYFRAANEKITADC 197 Query: 282 T 280 T Sbjct: 198 T 198 >SB_52413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 30.3 bits (65), Expect = 0.84 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 Query: 41 PDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 PDGWE S G+ YY+N T SQ E P Sbjct: 365 PDGWEQVESPQYGI-YYVNHATGSSQREHP 393 >SB_28746| Best HMM Match : UPF0193 (HMM E-Value=0.31) Length = 927 Score = 30.3 bits (65), Expect = 0.84 Identities = 19/58 (32%), Positives = 27/58 (46%) Frame = +2 Query: 110 KSQWERPEAPAELTEIRCSHILVKHVQSRRPSSWREDNITRSKEEALEILKKYRKQIV 283 KSQW++P P+ E L K + + DNIT + +AL LK R I+ Sbjct: 395 KSQWQQPPQPSVALETFLE--LTKSELANLSFEAQSDNITTGERQALNDLKNNRDIII 450 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 44 DGWEMRTSRSTGMSYYLNTYTKKSQWERPE 133 D W + S G +YY N T++S WE+P+ Sbjct: 85 DIW-LEHKTSDGKTYYYNARTRESAWEKPK 113 Score = 27.1 bits (57), Expect = 7.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 71 STGMSYYLNTYTKKSQWERPE 133 S G Y+ N+ T +S WERP+ Sbjct: 425 SDGRVYFYNSRTMQSTWERPK 445 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 74 TGMSYYLNTYTKKSQWERPE 133 TG +++ N T+ S WE+PE Sbjct: 534 TGKAFFFNPATRLSVWEKPE 553 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 26 NDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 +D LP GWE G +YY++ KK+Q+E P Sbjct: 326 DDDELPYGWEKVDDPKYG-TYYIDHINKKTQFENP 359 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 35 PLPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 PLPD WE+ + T Y+++ T +QW P Sbjct: 282 PLPDNWEVAYT-ETNEKYFIDHKTGTTQWVDP 312 >SB_44622| Best HMM Match : dsrm (HMM E-Value=3.1e-16) Length = 724 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 38 LPDGWEMRTSRSTGMSYYLNTYTKKSQWERP 130 LPDGW RS G+ YL+ T+ W RP Sbjct: 52 LPDGWLALNHRSGGI-IYLHRPTRVCTWSRP 81 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 74 TGMSYYLNTYTKKSQWERPEAPAELTE 154 +G YY NT TK+S W P+ EL E Sbjct: 219 SGRVYYHNTETKESIWTEPKELTELKE 245 >SB_51384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 64 EPLNWDVILPEHIYQKITVGATRS 135 EPL D +H++QKITVG RS Sbjct: 189 EPLQPDETTRKHVWQKITVGPLRS 212 >SB_369| Best HMM Match : Pox_A32 (HMM E-Value=0.2) Length = 856 Score = 29.1 bits (62), Expect = 1.9 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLLRV--MLSS--RHDDG 199 ++ EY+ A+ TK+ S CLR+ + I+ L V M+ HDDG Sbjct: 481 EKMKEYMKALKTKMFSKLEFCLRHPYTIALVERLGEVERMVGKALTHDDG 530 >SB_33079| Best HMM Match : FYVE (HMM E-Value=1.1e-29) Length = 212 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +2 Query: 23 ENDAPLPDGWEMRTSRSTGMSYYLNTYTKKSQW 121 E+DA L +GW++ +++ + + Y T T+K++W Sbjct: 23 EDDANLKNGWQIISTKKS-FAVYAATATEKAEW 54 >SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1164 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 58 ENEPLNWDVILPEHIYQKITVGATRS 135 E EPL +H++ KITVGA RS Sbjct: 333 EAEPLQTGETTGKHVWHKITVGALRS 358 >SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) Length = 681 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLLRVMLSSRHDD 202 ++ EY+ A+ TK++S CLR+ + I+ + V + HDD Sbjct: 108 EKMKEYMKALKTKMLSKLEFCLRHPYTIALVEREM-VGKALTHDD 151 >SB_8941| Best HMM Match : VWA (HMM E-Value=0) Length = 2180 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 44 DGWEMRTSRSTGMSYYLNTYTKKSQWERPEAPAELT 151 DGW MR + + +N +KKS ++PE T Sbjct: 535 DGWRMRVTERRIKVFSVNLRSKKSTSDKPETDKSTT 570 >SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 345 RLADEQ-SEYLVAISTKVISLATICLRYFFNISRASSLL 232 +L++E+ EY+ A+ TK S CLR+ + I+ LL Sbjct: 375 KLSEEKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 413 >SB_28990| Best HMM Match : YABBY (HMM E-Value=0.45) Length = 853 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 392 MPSAFVLFRTFPSLRHVWLMSSQSI 318 +PSA V F T S+R VW +S S+ Sbjct: 191 LPSAIVAFGTVRSIRQVWQHTSHSL 215 >SB_58745| Best HMM Match : rve (HMM E-Value=0.0023) Length = 943 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 480 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 514 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 7 GENVKRK*RTVARRLGDENE--PLNWDVILPEHIYQKITVGATRSTCRAHGDPMQSY 171 GE +++ + RR+G + PL+W+ LP H+ ++ R H DP S+ Sbjct: 293 GEPARKERSSPERRMGKQRRDVPLDWEEPLPRHVDER-----PRRPHDHHADPYDSH 344 >SB_44641| Best HMM Match : rve (HMM E-Value=1.9e-19) Length = 840 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 131 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 165 >SB_40000| Best HMM Match : Pox_A32 (HMM E-Value=0.053) Length = 946 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 560 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVKRLL 594 >SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 1144 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 556 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 590 >SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) Length = 1081 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 391 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 425 >SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) Length = 1606 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNIS 250 ++ EY+ A+ TK S CLRY + I+ Sbjct: 562 EKMKEYMKALKTKKFSKLEFCLRYPYTIA 590 >SB_2035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNIS 250 ++ EY+ A+ TK S CLRY + I+ Sbjct: 69 EKMKEYMKALKTKKFSKLEFCLRYPYTIA 97 >SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 914 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 524 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 558 >SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) Length = 957 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 571 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 605 >SB_39424| Best HMM Match : Pox_A32 (HMM E-Value=0.033) Length = 1004 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 832 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 866 >SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) Length = 1264 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 563 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 597 >SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) Length = 745 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 215 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVERLL 249 >SB_54102| Best HMM Match : Pox_A32 (HMM E-Value=2.6) Length = 268 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNIS 250 ++ EY+ A+ TK S CLRY + I+ Sbjct: 156 EKMREYMKALKTKKFSKLEFCLRYPYTIA 184 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 27.1 bits (57), Expect = 7.8 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -1 Query: 471 RIIWYPESVSIGLLSCPI--GNVKASSSNAFCICPFPNIPKS-PPRLADEQSEY 319 RII + + L +C + G ASS+NA CICP N P P D+ Y Sbjct: 546 RIISRTKCNACTLSTCNLVYGTCSASSANASCICP-TNCPSDWDPVCGDDGVTY 598 >SB_57471| Best HMM Match : TatC (HMM E-Value=0.27) Length = 687 Score = 27.1 bits (57), Expect = 7.8 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -1 Query: 456 PESVSIGLLSCPIGNVKASSSNAF--CICPFPNIPKSPPRLADEQSEYLVAISTKVISLA 283 P SI + + S+S AF I P PN+ P L + VAIST+ S+A Sbjct: 554 PNVTSITTIKIDDTSRTPSASVAFETTITPSPNVTSYQPLLMTSSA---VAISTRAASIA 610 Query: 282 TI 277 TI Sbjct: 611 TI 612 >SB_52465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 27.1 bits (57), Expect = 7.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLLRVMLSSR 211 ++ EY+ A+ TK S CLR+ + I+ L V +S+ Sbjct: 166 EKMKEYIKALKTKKFSKLEFCLRHPYTIALVERLGEVERNSK 207 >SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) Length = 1058 Score = 27.1 bits (57), Expect = 7.8 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 126 DQKHLQSSRRSDAVISWSNMCKAAGRHH-GVRTTLHAARRRLW 251 D +H+Q + +D I + + + G+ H G++T LHA +W Sbjct: 957 DVRHVQEA--TDLAIEYIHAVQGDGKEHFGLKTALHANMPSVW 997 >SB_29566| Best HMM Match : HypA (HMM E-Value=0.38) Length = 701 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNIS 250 +E EY+ A+ TK S CLR+ + I+ Sbjct: 449 EEMKEYMKALKTKKFSKLEFCLRHPYTIA 477 >SB_18915| Best HMM Match : Pox_A32 (HMM E-Value=0.052) Length = 430 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 339 ADEQSEYLVAISTKVISLATICLRYFFNIS 250 A++ EY+ A+ TK S CLR+ + I+ Sbjct: 317 AEKMKEYMKALKTKKFSKLEFCLRHPYTIA 346 >SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) Length = 960 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLL 232 ++ EY+ A+ TK S CLR+ + I+ LL Sbjct: 566 EKMKEYMNALKTKKFSKLEFCLRHPYTIALVERLL 600 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNIS 250 ++ EY+ A+ TK S CLRY + I+ Sbjct: 1599 EKMREYMKALKTKKFSKLEFCLRYPYTIA 1627 >SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 336 DEQSEYLVAISTKVISLATICLRYFFNISRASSLLRVML 220 ++ EY+ A+ TK S CLR+ + I+ L+ +L Sbjct: 564 EKMKEYMKALKTKKFSKLEFCLRHPYTIALVEQNLKEVL 602 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.1 bits (57), Expect = 7.8 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 269 RKQIVANDITFVDIATKYSDCSSAKRGGDLGMFGKGQMQKAFEEEAFTLPIGQLSKPIET 448 + ++ + I+ D + YS + +G G GKG +K+ + L +GQ K I+ Sbjct: 1091 KASVLRDRISHDDRDSTYSPIPTPTKGRGRGKRGKGAPKKSNKSAVALLEVGQDWKTIDP 1150 Query: 449 DS 454 +S Sbjct: 1151 ES 1152 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,876,036 Number of Sequences: 59808 Number of extensions: 336939 Number of successful extensions: 1248 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1245 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -