BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K17 (460 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 26 0.19 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 3.2 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 21 4.2 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 20 9.6 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 25.8 bits (54), Expect = 0.19 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 203 PILGAKEDVAPTSPPT 156 PIL K V+PT+PPT Sbjct: 85 PILAEKVSVSPTTPPT 100 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 3.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 254 VALAMSSPTFFGERPRGPILGAKEDVAPTSPPT 156 + + +S+PT FG R L DV P + T Sbjct: 166 IGVQISAPTIFGARHGLETLSQLMDVYPNNDGT 198 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 21.4 bits (43), Expect = 4.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 176 LRPPWLLKSVPLVSPQKRLVMTSLK 250 +RPP L + P+ +PQ ++ T K Sbjct: 101 IRPPILHDTQPMCNPQLQVPRTFFK 125 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.2 bits (40), Expect = 9.6 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +3 Query: 408 WKYPNGRCHWHC 443 W Y R H HC Sbjct: 84 WVYYESRAHIHC 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,823 Number of Sequences: 336 Number of extensions: 2170 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -