BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K17 (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19611| Best HMM Match : No HMM Matches (HMM E-Value=.) 207 3e-54 SB_22058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_20269| Best HMM Match : SOCS_box (HMM E-Value=4.6e-05) 30 1.1 SB_57115| Best HMM Match : HALZ (HMM E-Value=7.6) 29 1.8 SB_56062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_23193| Best HMM Match : Lipoprotein_17 (HMM E-Value=2.3) 29 1.8 SB_22517| Best HMM Match : UPF0081 (HMM E-Value=1) 29 1.8 SB_15149| Best HMM Match : HALZ (HMM E-Value=7.6) 29 1.8 SB_58285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_53864| Best HMM Match : Herpes_US9 (HMM E-Value=2) 28 3.2 SB_28159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_43217| Best HMM Match : NUMOD3 (HMM E-Value=0.56) 28 4.3 SB_34911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_34579| Best HMM Match : IncA (HMM E-Value=0.99) 27 5.6 SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) 27 5.6 SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) 27 5.6 SB_9681| Best HMM Match : IncA (HMM E-Value=0.58) 27 5.6 SB_3212| Best HMM Match : APC10 (HMM E-Value=0.36) 27 5.6 SB_34694| Best HMM Match : IncA (HMM E-Value=0.33) 27 7.5 SB_58064| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_26153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35) 27 9.9 SB_56403| Best HMM Match : fn3 (HMM E-Value=1.5e-29) 27 9.9 SB_29133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_7181| Best HMM Match : C2 (HMM E-Value=1.2e-15) 27 9.9 >SB_19611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 207 bits (506), Expect = 3e-54 Identities = 95/118 (80%), Positives = 108/118 (91%) Frame = +1 Query: 106 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITV 285 MPPKFDPNEI+ V LRC GGEVGAT+SLAPKIGPLGLSPKKVGDDIAKAT DWKGLKITV Sbjct: 1 MPPKFDPNEIQYVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKATQDWKGLKITV 60 Query: 286 QLIVQNRQAQISVVPSAAALIIRALKEPPRDRKKQKNIKHNGNIPMEDVIGIAQIMRP 459 L +QNRQA++SVVPSA++LII+ALKEPPRDRKK KNIKHNGNI ++DV +A++MRP Sbjct: 61 CLTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKVKNIKHNGNITLDDVTNVAKVMRP 118 >SB_22058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 31.5 bits (68), Expect = 0.35 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -3 Query: 203 PILGAKEDVAPTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLY 69 PIL AK+ + PT PP +LT ++ G+ G T +CN +Y Sbjct: 121 PILPAKKLIYPTPPPNFRRLTGGLTQGNESG----TPFCNQNRVY 161 >SB_20269| Best HMM Match : SOCS_box (HMM E-Value=4.6e-05) Length = 302 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 274 KITVQLIVQNRQAQISVVPSAAALIIRALKEPPRDRKKQKNIKH 405 ++ ++ + RQ + +PSA IR +E PR +K N+KH Sbjct: 97 RVIIRAVGSRRQVEPLPLPSALKEWIREYEEEPRFDRKLTNLKH 140 >SB_57115| Best HMM Match : HALZ (HMM E-Value=7.6) Length = 209 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 371 GGSLRALMISAAAEGTTEICACLFCTIN 288 GG L+ L++S G T ACL+C ++ Sbjct: 59 GGDLKFLLLSMGLSGATSDYACLWCIVH 86 >SB_56062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 371 GGSLRALMISAAAEGTTEICACLFCTIN 288 GG L+ L++S G T ACL+C ++ Sbjct: 459 GGDLKFLLLSMGLSGATSDYACLWCIVH 486 >SB_23193| Best HMM Match : Lipoprotein_17 (HMM E-Value=2.3) Length = 711 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 371 GGSLRALMISAAAEGTTEICACLFCTIN 288 GG L+ L++S G T ACL+C ++ Sbjct: 459 GGDLKFLLLSMGLSGATSDYACLWCIVH 486 >SB_22517| Best HMM Match : UPF0081 (HMM E-Value=1) Length = 2568 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +1 Query: 166 EVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITVQLIVQNRQAQISVVPS 333 E+G T + + LG PK V +D +DW + I + I++ PS Sbjct: 1793 ELGITDAEGNYVDSLGADPKAVSNDYVGYATDWVNNNLPENAITNSTWTGIALGPS 1848 >SB_15149| Best HMM Match : HALZ (HMM E-Value=7.6) Length = 328 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 371 GGSLRALMISAAAEGTTEICACLFCTIN 288 GG L+ L++S G T ACL+C ++ Sbjct: 59 GGDLKFLLLSMGLSGATSDYACLWCIVH 86 >SB_58285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 431 TSSIGIFPLCLMFF-CFLRSRGGSLRALMISAAAEGTTEICACLFCTINWT 282 + S + CL+ F CF RG +L+ ++ C +FC WT Sbjct: 435 SKSAHVNAFCLLHFTCFHPYRGKTLKTARLTVVQGRGRSCCKPVFCARRWT 485 >SB_53864| Best HMM Match : Herpes_US9 (HMM E-Value=2) Length = 615 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 200 ILGAKEDVAP-TSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 + + DV P T P TH+ T S+G ++ L C+ +++ +N Sbjct: 397 VAASSSDVCPPTRPQTHMTPTAPASIGGDVQSFRLQKICDTQAVLDN 443 >SB_28159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 27.9 bits (59), Expect = 4.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 202 GPLGLSPKKVGDDIAKATSDWKG 270 GPLG+ +++ D ++SDW G Sbjct: 337 GPLGMEDRRIQDSQINSSSDWDG 359 >SB_43217| Best HMM Match : NUMOD3 (HMM E-Value=0.56) Length = 311 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/75 (25%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = -3 Query: 284 TVILRPFQSLVALAMSSPTFFGERPRGPI-LGAKEDVAPTSPPTHLKLTILISLGSNLGG 108 T L P +AL F L AKE P TH+ T S+G ++ Sbjct: 82 TAKLDPLTGKIALVSKGVAFLNAELCALFGLEAKETAGVCPPQTHMTPTAPASIGGDVQS 141 Query: 107 IVLTNYCNNKSLYNN 63 L C+ +++ +N Sbjct: 142 FRLQKICDTQAVLDN 156 >SB_34911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 904 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 383 LRSRGGSLRALMISAAAEGTTEICACLFCTINWTVILRP 267 +R +G SL++L+ + IC CL C I+ V+ P Sbjct: 175 IRYKGKSLKSLIARGLIKVHPPICDCLGCRISSPVVASP 213 >SB_34579| Best HMM Match : IncA (HMM E-Value=0.99) Length = 346 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 173 PTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 PT P TH+ T S+G ++ L C+ +++ +N Sbjct: 138 PTRPQTHMTPTAPASIGGDVQSFRLQKICDTQAVLDN 174 >SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1492 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = -2 Query: 297 HYQLDRDLETLPVTSGFSDVITNL-----FWGETKGTDFRSQGGRSTDFSTNTS 151 +Y + +PVT F D + N WG+ KG R G ++ NT+ Sbjct: 741 NYNFTKMFSFVPVTKQFQDYLVNSNLVIEVWGKQKGRKSRKPGAPASSQQKNTA 794 >SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) Length = 477 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 173 PTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 PT P TH+ T S+G ++ L C+ +++ +N Sbjct: 21 PTRPQTHMTPTAPASIGGDVQSFRLQKICDTQAVLDN 57 >SB_9681| Best HMM Match : IncA (HMM E-Value=0.58) Length = 215 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 173 PTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 PT P TH T S+G ++ L C+ +++++N Sbjct: 5 PTCPQTHTTPTAPASIGGDVQSFRLQKICDTQAVHDN 41 >SB_3212| Best HMM Match : APC10 (HMM E-Value=0.36) Length = 646 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 124 PNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVG 234 P+ +L+C G E TSS+ P +G LG K G Sbjct: 597 PSMTNTTSLKCQGDEKSGTSSITP-LGSLGTYDKSHG 632 >SB_34694| Best HMM Match : IncA (HMM E-Value=0.33) Length = 404 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 200 ILGAKEDVA-PTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 + + DV PT P TH T S+G ++ L C+ +++ +N Sbjct: 188 VAASSSDVCLPTCPQTHTTPTAPASIGGDVQSFRLQKICDTQAVLDN 234 >SB_58064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1027 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 200 ILGAKEDVA-PTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 + + DV PT P TH T S+G ++ L C+ +++ +N Sbjct: 188 VAASSSDVCLPTCPQTHTTPTAPASIGGDVQSFRLQKICDTQAVLDN 234 >SB_26153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 416 IFPLCLMFFCFLR 378 I PLC+M FC+LR Sbjct: 199 IIPLCIMVFCYLR 211 >SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35) Length = 1595 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 331 SAAALIIRALKEPPRDRKKQKNIKHNGNI-PMEDVI 435 SAA +I R L+EP R+ Q N H+ + P+ D I Sbjct: 200 SAAQVIQRILEEPDDPRENQSNNPHDQSTRPLSDKI 235 >SB_56403| Best HMM Match : fn3 (HMM E-Value=1.5e-29) Length = 236 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -3 Query: 203 PILGAKEDVAPTSPPTHLKLTILISLGSNLGGIVLTNYCNN 81 P +G + AP PT L T+L S + L C N Sbjct: 130 PYIGRTREDAPDCAPTSLSTTVLTSTSIRVTWSALPGTCTN 170 >SB_29133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 173 PTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 PT P TH T S+G ++ L C+ +++ +N Sbjct: 21 PTCPQTHTTPTAPASIGGDVQSFQLQKICDTQAVLDN 57 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 236 SPTFFGERPRGPILGAKEDVAP 171 S TF +P GP+ G K DVAP Sbjct: 958 SGTFTAVQPDGPLRGEKLDVAP 979 >SB_7181| Best HMM Match : C2 (HMM E-Value=1.2e-15) Length = 630 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 197 LGAKED--VAPTSPPTHLKLTILISLGSNLGGIVLTNYCNNKSLYNN 63 L AK+D P P TH+ T S+G ++ L C+ +++ +N Sbjct: 112 LEAKDDHVCPPICPQTHMTPTAPASIGGDVQSFRLQKICDTQAVLDN 158 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,885,572 Number of Sequences: 59808 Number of extensions: 260105 Number of successful extensions: 836 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -