BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K16 (401 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.06 |rps2801|rps28-1|40S ribosomal protein S28|Schizosa... 74 7e-15 SPCC285.15c |rps2802|rps28-2, rps28|40S ribosomal protein S28|Sc... 74 7e-15 SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 25 5.8 SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces ... 25 5.8 >SPAC25G10.06 |rps2801|rps28-1|40S ribosomal protein S28|Schizosaccharomyces pombe|chr 1|||Manual Length = 68 Score = 74.1 bits (174), Expect = 7e-15 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 67 PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 213 P LA+V+KVLGRTGS+G TQV+VEF+ +TSR IIRNVKGPVR+ DIL Sbjct: 7 PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55 >SPCC285.15c |rps2802|rps28-2, rps28|40S ribosomal protein S28|Schizosaccharomyces pombe|chr 3|||Manual Length = 68 Score = 74.1 bits (174), Expect = 7e-15 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 67 PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 213 P LA+V+KVLGRTGS+G TQV+VEF+ +TSR IIRNVKGPVR+ DIL Sbjct: 7 PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 24.6 bits (51), Expect = 5.8 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -3 Query: 258 PLSKSPGFTLRLEKGQ--DVSVADRSLHVPDDLTASLSDELHFDLSTLSL*SGAAEHFHD 85 P+S PG + ++ + + D S+ ++LTAS +E H++L T + + Sbjct: 391 PVSSQPGSDAKSQEFDFFEAKIPD-SIAKLNELTAS--NENHYELKTYDRAERLRQKIQE 447 Query: 84 TSKNVRLI 61 S N RLI Sbjct: 448 VSSNKRLI 455 >SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 227 Score = 24.6 bits (51), Expect = 5.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 380 RIIYILRAEYRDIVIFDGFILMLTHKFG*LVHY 282 R++Y + A +VIFDGF L+ F HY Sbjct: 47 RLVYFIMAVMVFLVIFDGFPFWLS-AFSIFSHY 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,551,799 Number of Sequences: 5004 Number of extensions: 27959 Number of successful extensions: 73 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -