BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K15 (502 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0135 - 13027496-13027933 33 0.097 07_03_0180 + 14804784-14805231,14806855-14806892,14807135-14807143 33 0.097 04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420... 33 0.13 01_05_0044 + 17531005-17531739,17532624-17532956,17532968-17533027 33 0.13 06_03_0223 - 18391177-18391287,18391570-18392081,18392200-183930... 32 0.23 03_05_0310 + 23008915-23009841,23010401-23011162 32 0.23 11_04_0032 + 12545208-12545954 31 0.39 09_06_0375 - 22653366-22657112,22657185-22658457,22658833-22659539 31 0.69 04_04_1405 - 33305948-33309676,33309749-33310468,33310533-333114... 31 0.69 04_03_0027 + 9667508-9668800 30 0.91 06_02_0306 + 14115751-14116450,14116882-14117691,14118957-14119141 30 1.2 02_03_0058 + 14536336-14536593,14536715-14536984 30 1.2 07_01_0279 + 2055310-2055541,2055916-2056235,2056734-2057213 29 1.6 03_05_0186 + 21731294-21732277 29 2.1 03_01_0330 + 2566662-2566740,2566821-2566911,2567003-2567057,256... 29 2.8 08_02_0360 + 16196712-16197560,16198126-16198875 28 3.7 05_03_0344 - 12744727-12744837,12745116-12745574 28 3.7 11_04_0146 - 14091671-14092357,14092996-14093229 28 4.8 08_02_0235 + 14627648-14628889 28 4.8 11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644 27 8.5 10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834 27 8.5 10_02_0198 - 6611775-6612611 27 8.5 05_06_0064 + 25297268-25297612,25298150-25298237,25299608-252997... 27 8.5 05_03_0216 + 10370531-10371922,10378656-10378808 27 8.5 04_01_0187 - 2153546-2154520,2154581-2155858 27 8.5 >08_02_0135 - 13027496-13027933 Length = 145 Score = 33.5 bits (73), Expect = 0.097 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 26 DQNWYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 ++ W + +P L R A K IG + ++VYG+T +LP Sbjct: 84 EEGWKDKLPDALWAYRTAHKTPIGMTPYQIVYGKTCQLP 122 >07_03_0180 + 14804784-14805231,14806855-14806892,14807135-14807143 Length = 164 Score = 33.5 bits (73), Expect = 0.097 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W +P L R A+K IG S +LVYG+T LP Sbjct: 5 WKNKLPDALWAYRTAYKMPIGMSPYQLVYGKTCHLP 40 >04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902, 4208006-4208297,4209278-4209569,4210013-4210465 Length = 783 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W + +P L R A+K IG S ++VYG++ +LP Sbjct: 725 WKDRLPDTLWAYRTAYKTPIGMSPYQIVYGKSYRLP 760 >01_05_0044 + 17531005-17531739,17532624-17532956,17532968-17533027 Length = 375 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W + +P L R A+K IG S ++VYG++ +LP Sbjct: 96 WKDRLPDALWAYRTAYKTPIGMSPYQIVYGKSCRLP 131 >06_03_0223 - 18391177-18391287,18391570-18392081,18392200-18393019, 18393603-18393671,18393973-18394062,18395381-18395575 Length = 598 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W +P L R A+K IG S +LVYG+T P Sbjct: 413 WKNKLPDALWAYRTAYKTPIGMSPYQLVYGKTCHFP 448 >03_05_0310 + 23008915-23009841,23010401-23011162 Length = 562 Score = 32.3 bits (70), Expect = 0.23 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W + +P L R A+K IG S ++VYG+ +LP Sbjct: 160 WKDRLPDALWAYRTAYKTPIGMSPYQIVYGKPCRLP 195 >11_04_0032 + 12545208-12545954 Length = 248 Score = 31.5 bits (68), Expect = 0.39 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 29 QNWYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 ++W +P L R A+K IG S +LVY +T LP Sbjct: 60 KSWKNKLPDALWAYRTAYKTPIGMSPYQLVYRKTCHLP 97 >09_06_0375 - 22653366-22657112,22657185-22658457,22658833-22659539 Length = 1908 Score = 30.7 bits (66), Expect = 0.69 Identities = 22/65 (33%), Positives = 31/65 (47%) Frame = +2 Query: 20 HSDQNWYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLPSDFFLASSVAEVTDYSDFL 199 H D +W E +P +L R G + LVYG LPS+ L S A + +D Sbjct: 1741 HGD-SWIEELPAVLWANRTIPSRATGETPFFLVYGAEAVLPSELTLRSPRATMYCEAD-Q 1798 Query: 200 SRLRR 214 ++LRR Sbjct: 1799 NQLRR 1803 >04_04_1405 - 33305948-33309676,33309749-33310468,33310533-33311439, 33334405-33334484 Length = 1811 Score = 30.7 bits (66), Expect = 0.69 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = +2 Query: 20 HSDQNWYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLPSDFFLASSVAEVTDYSDFL 199 H D +W E +P +L R G + LVYG LPS+ L S A + +D Sbjct: 1650 HGD-SWIEELPAVLWANRTTPSRATGETPFFLVYGAEAVLPSELTLRSPRATMYCEAD-Q 1707 Query: 200 SRLRR 214 +LRR Sbjct: 1708 DQLRR 1712 >04_03_0027 + 9667508-9668800 Length = 430 Score = 30.3 bits (65), Expect = 0.91 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W +P L R + IG S +LVYG+T LP Sbjct: 382 WKNKLPNALWAYRTTYNMPIGMSPYQLVYGKTCHLP 417 >06_02_0306 + 14115751-14116450,14116882-14117691,14118957-14119141 Length = 564 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W E + L R +K IG S ++VYG++ +LP Sbjct: 89 WKEKLSDALWAYRTTYKTPIGMSPYQIVYGKSCRLP 124 >02_03_0058 + 14536336-14536593,14536715-14536984 Length = 175 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W + +P L R A+K IG +VYG++ +LP Sbjct: 113 WKDRLPDALWAYRTAYKTPIGMFRYHIVYGKSCRLP 148 >07_01_0279 + 2055310-2055541,2055916-2056235,2056734-2057213 Length = 343 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 140 PSDFFLASSVAEVTDYSDFLSRLRRYMCNLKPTTVTRHG 256 PSDF S+V ++ F R R+Y +++P VT G Sbjct: 73 PSDFLKTSTVGSEKEWYFFCLRGRKYRNSIRPNRVTGSG 111 >03_05_0186 + 21731294-21732277 Length = 327 Score = 29.1 bits (62), Expect = 2.1 Identities = 33/148 (22%), Positives = 60/148 (40%), Gaps = 15/148 (10%) Frame = +2 Query: 26 DQNWYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLPSDFFLASSVAEVTDY-SDFLS 202 D + Y+ +P N+++ + + E +YG + P L E Y +D L Sbjct: 173 DGSCYKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP---LLWDQTGERQVYGTDILR 229 Query: 203 RLRRYMCNLKPT---TVTRHGKSNIFVHKDL--QKSSQVFLRTDAL--------KRALQP 343 + ++ RH + +DL +K V+LR L K L P Sbjct: 230 EAEEKVKIIQERLRIAQCRHKRYADNRRRDLSFEKGDHVYLRVTPLRGVYRFHTKGKLAP 289 Query: 344 PYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 + GPYK++S R + +Q+++ + V Sbjct: 290 RFVGPYKIVSRRGEVAYQLELPQSLAGV 317 >03_01_0330 + 2566662-2566740,2566821-2566911,2567003-2567057, 2567166-2567297,2567517-2567567,2567769-2567840, 2568590-2568680,2568988-2569066,2569147-2569210, 2569917-2570020,2570182-2570287,2572080-2572157, 2572649-2572801,2573039-2573128,2573284-2573349, 2573485-2573583,2573660-2573734,2574455-2574514, 2574909-2574998,2575202-2575323,2575462-2575591, 2575662-2575741,2576167-2576302,2577005-2577086, 2578475-2578620,2578796-2578876,2578994-2579094, 2579770-2580008,2580100-2580209,2580518-2580646, 2580728-2580802,2581455-2581586,2582298-2582470, 2582566-2582688,2582771-2582831,2582910-2583005, 2583251-2583351,2584014-2584119,2584673-2584786, 2584888-2584962,2585619-2585711,2585883-2585954, 2586253-2586338,2586434-2586527,2586596-2586703, 2586782-2587021 Length = 1579 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 179 TDYSDFLSRLRRYMCNLKPTTVTRHGKSNI 268 +DY DF+ L R +C L P V + +S I Sbjct: 1434 SDYEDFIRDLTRQLCRLSPARVDSYFESAI 1463 >08_02_0360 + 16196712-16197560,16198126-16198875 Length = 532 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W + + L R +K IG S ++VYG++ +LP Sbjct: 134 WKDRLSDALWAYRTVYKTPIGMSPYQIVYGKSYRLP 169 >05_03_0344 - 12744727-12744837,12745116-12745574 Length = 189 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKLP 142 W + L R A+K IG S +LVYG+T P Sbjct: 5 WKNKLLDALWAYRTAYKTPIGMSPYQLVYGKTCHFP 40 >11_04_0146 - 14091671-14092357,14092996-14093229 Length = 306 Score = 27.9 bits (59), Expect = 4.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 35 WYEVIPLILLGIRNAWKEDIGSSSAELVYGETLKL 139 W + L R A+K IG S +LVYG+T L Sbjct: 187 WKNKLSDALWAYRTAYKTPIGMSPYQLVYGKTCHL 221 >08_02_0235 + 14627648-14628889 Length = 413 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 323 LKRALQPPYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 +K L P + GPYK++S R + +Q+++ + V Sbjct: 283 IKGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGV 317 >11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644 Length = 581 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 326 KRALQPPYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 K L P + GPYK++S R + +Q+++ + V Sbjct: 452 KGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGV 485 >10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834 Length = 324 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 326 KRALQPPYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 K L P + GPYK++S R + +Q+++ + V Sbjct: 195 KGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGV 228 >10_02_0198 - 6611775-6612611 Length = 278 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 326 KRALQPPYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 K L P + GPYK++S R + +Q+++ + V Sbjct: 149 KGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGV 182 >05_06_0064 + 25297268-25297612,25298150-25298237,25299608-25299719, 25300417-25300972 Length = 366 Score = 27.1 bits (57), Expect = 8.5 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Frame = +2 Query: 134 KLPSDFFLASSVAE-VTDYSDFLSRLRRYMCNLKPTTVTRHGKSNIFVHKDLQKSSQVFL 310 K S F+L S+ + +TD FL RR+ + + ++F + S FL Sbjct: 131 KKNSTFYLYLSLTQALTDKGKFLLAARRFRNGAHTEYIISYDCDDLFPGSN----SSDFL 186 Query: 311 RTDALKRALQPPYTGPYKVISRSDKTF 391 T + QPPY G S+S + F Sbjct: 187 GTKFIIYDSQPPYDGAKPSRSQSSRRF 213 >05_03_0216 + 10370531-10371922,10378656-10378808 Length = 514 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 326 KRALQPPYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 K L P + GPYK++S R + +Q+++ + V Sbjct: 417 KGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGV 450 >04_01_0187 - 2153546-2154520,2154581-2155858 Length = 750 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 326 KRALQPPYTGPYKVIS-RSDKTFQIDIAGKIVTV 424 K L P + GPYK++S R + +Q+++ + V Sbjct: 667 KGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGV 700 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,359,551 Number of Sequences: 37544 Number of extensions: 218901 Number of successful extensions: 488 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -