BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K13 (531 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 6.8 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.9 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 411 DEETGIPFRGLFIIDDKQN 467 D ++ +PF GLFI + N Sbjct: 15 DSDSKLPFSGLFIENQAGN 33 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.6 bits (41), Expect = 8.9 Identities = 12/47 (25%), Positives = 17/47 (36%) Frame = -2 Query: 158 LKIREGDVFELSVDDGCRLELWSWLSQLQRHSVEIYDSLFEMSRKLR 18 L + ++EL D + WL EI + LF LR Sbjct: 277 LDLSHNSLYELDFDTFRNTKKLQWLDTSHNRISEIPNDLFRFLGNLR 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,777 Number of Sequences: 336 Number of extensions: 1882 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -