BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K13 (531 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.1 U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 22 3.4 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 3.4 AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 3.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 3.4 AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. 22 4.5 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 108 TAVVNGEFKDVALSDF 155 T +++ FKDV LSDF Sbjct: 1401 TPIMDAHFKDVKLSDF 1416 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 168 VVLFFYPLDFTFVCPTEIIAFSERADDFRKIGCEVIA 278 V + P++ F P E ERAD R++ C++++ Sbjct: 15 VAIMAAPVEDEFE-PLEHFENEERADRHRRVTCDLLS 50 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 514 STDRPTGRSLTVICRRFCLSSM 449 ST+R S+ +IC C+S + Sbjct: 280 STERMIAASVNLICHILCMSDL 301 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 168 VVLFFYPLDFTFVCPTEIIAFSERADDFRKIGCEVIA 278 V + P++ F P E ERAD R++ C++++ Sbjct: 15 VAIMAAPVEDEFE-PLEHFENEERADRHRRVTCDLLS 50 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -2 Query: 236 LRESDYLCRAYEREIKRIEE*HDVFPLKIREGDVFELSVDDG 111 ++ S R Y+RE++ + FP+K FE +++G Sbjct: 288 VKNSGQWLREYDRELEDFDGRLFEFPIKFVPSYPFEEDINEG 329 >AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. Length = 57 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 210 PTEIIAFSERADDFRKIGCEVIA 278 P E ERAD R++ C++++ Sbjct: 3 PLEHFENEERADRHRRVTCDLLS 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,272 Number of Sequences: 438 Number of extensions: 2112 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -