BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K11 (364 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_45114| Best HMM Match : RasGEF (HMM E-Value=3.7e-24) 26 8.0 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 26.6 bits (56), Expect = 6.0 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -2 Query: 216 QYTS*QPYVIIVVYNNRYDITGTEQYCNTFNKAQGITIFSRDQVTKN 76 QY + V YN RYDI T QY + ++ D V+ N Sbjct: 147 QYDTRYDIVSTTQYNTRYDIVSTTQYDTQSTRYDIVSTTQCDIVSTN 193 >SB_45114| Best HMM Match : RasGEF (HMM E-Value=3.7e-24) Length = 315 Score = 26.2 bits (55), Expect = 8.0 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 166 IRYNRNRAILQYIQ*GTRHHNILSRSSYEEHSFSKIINYLAAPEHIMD 23 + +++ R I Q IQ RH+ ++ Y K+I+YL A E +MD Sbjct: 243 VNFSKMRMIAQVIQ-EIRHYQ---QTPYAIQGDRKVIHYLTAKELLMD 286 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,792,809 Number of Sequences: 59808 Number of extensions: 144637 Number of successful extensions: 248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 248 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -