BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K09 (465 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC125149-1|AAI25150.1| 292|Homo sapiens claudin 23 protein. 32 0.85 BC125148-1|AAI25149.1| 292|Homo sapiens claudin 23 protein. 32 0.85 >BC125149-1|AAI25150.1| 292|Homo sapiens claudin 23 protein. Length = 292 Score = 32.3 bits (70), Expect = 0.85 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -3 Query: 328 ISIFICPCFLFASKRAPVVPRGTRLSDMLLNLLVNISLFQGMWMCC 191 + + + PC L + + P G RL LN V++ L+QG+W C Sbjct: 9 LGMVLAPCGLLLNLTGTLAP-GWRLVKGFLNQPVDVELYQGLWDMC 53 >BC125148-1|AAI25149.1| 292|Homo sapiens claudin 23 protein. Length = 292 Score = 32.3 bits (70), Expect = 0.85 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -3 Query: 328 ISIFICPCFLFASKRAPVVPRGTRLSDMLLNLLVNISLFQGMWMCC 191 + + + PC L + + P G RL LN V++ L+QG+W C Sbjct: 9 LGMVLAPCGLLLNLTGTLAP-GWRLVKGFLNQPVDVELYQGLWDMC 53 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,153,911 Number of Sequences: 237096 Number of extensions: 1221132 Number of successful extensions: 2179 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2179 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3986009860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -