BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K09 (465 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT009995-1|AAQ22464.1| 1164|Drosophila melanogaster RE37196p pro... 29 3.1 AE013599-2768|AAF57637.2| 1541|Drosophila melanogaster CG15080-P... 29 3.1 >BT009995-1|AAQ22464.1| 1164|Drosophila melanogaster RE37196p protein. Length = 1164 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 461 TRRPLLDI-SPAICKTSSLLSFREEDSSFLLQQHRL 357 TRRP+L PA+ K +S +S+ E +SS HR+ Sbjct: 450 TRRPVLRTRKPAVTKVTSSVSYSESESSNKQPTHRI 485 >AE013599-2768|AAF57637.2| 1541|Drosophila melanogaster CG15080-PA protein. Length = 1541 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 461 TRRPLLDI-SPAICKTSSLLSFREEDSSFLLQQHRL 357 TRRP+L PA+ K +S +S+ E +SS HR+ Sbjct: 827 TRRPVLRTRKPAVTKVTSSVSYSESESSNKQPTHRI 862 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,143,554 Number of Sequences: 53049 Number of extensions: 387154 Number of successful extensions: 834 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1559812275 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -