BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K09 (465 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 2.8 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 3.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 3.7 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.6 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 2.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -2 Query: 359 LFHSSRHYVIYIHFYMSLFFIRIQACASCTARDAFV*YASKFTGKYFF 216 +F SS +Y F++ + I + +A V TG+Y F Sbjct: 1 MFFSSGKQQVYQLFFIQIVLIIVMGALMTYGPEANVNLLKNRTGRYMF 48 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 427 FARPQAFYRFVRKIHHFSCNSTVCSILHAIM*FISIFI 314 F+R F+RF R+I H + S L ++ + S ++ Sbjct: 186 FSRLVVFFRFERQIGHHLIQTFAPSTLVVMLSWFSFWL 223 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 3.7 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 310 PCFLFASKRAPVVPRGTRLSDMLLNLL 230 PC L AS APVV S +L +L Sbjct: 1105 PCVLRASTPAPVVLEAVHASRRVLIVL 1131 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 142 MINKLKFQCPLTEVPNYNTSTFPEIKKYLPVNLE 243 M + + L V +++ T+ IKK VN+E Sbjct: 1 MYGFVNYALELLVVKTFDSETWEAIKKDAAVNME 34 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 142 MINKLKFQCPLTEVPNYNTSTFPEIKKYLPVNLE 243 M + + L V +++ T+ IKK VN+E Sbjct: 1 MYGFVNYALELLVVKTFDSETWEAIKKDAAVNME 34 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,309 Number of Sequences: 438 Number of extensions: 2979 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -