BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K05 (403 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 27 0.19 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 27 0.34 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 1.0 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 25 1.4 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 25 1.4 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 25 1.4 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 23 4.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 5.5 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 22 7.3 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 22 7.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 9.6 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 27.5 bits (58), Expect = 0.19 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 335 VLATRYLELIVVVAVKDFEYFD*HQLQ 255 + R LEL+ + +KDF++F H++Q Sbjct: 89 IYVVRDLELVKQICIKDFDHFVNHRIQ 115 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 26.6 bits (56), Expect = 0.34 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 351 GGLEDGACDTLPGANC 304 G L++G C+T PG +C Sbjct: 82 GNLQNGTCETRPGGSC 97 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 25.0 bits (52), Expect = 1.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 317 LELIVVVAVKDFEYF 273 LELI + VKDF+YF Sbjct: 89 LELIKAIFVKDFQYF 103 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 24.6 bits (51), Expect = 1.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 341 KTVLATRYLELIVVVAVKDFEYF 273 K V LEL+ V VKDF+YF Sbjct: 20 KPVALVTDLELVKNVFVKDFQYF 42 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 24.6 bits (51), Expect = 1.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 341 KTVLATRYLELIVVVAVKDFEYF 273 K V LEL+ V VKDF+YF Sbjct: 20 KPVALITDLELLKCVFVKDFQYF 42 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.6 bits (51), Expect = 1.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 341 KTVLATRYLELIVVVAVKDFEYF 273 K V LEL+ V VKDF+YF Sbjct: 80 KPVALITDLELLKCVFVKDFQYF 102 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.0 bits (47), Expect = 4.2 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -2 Query: 384 CEPPGT---STPLDGGLEDGACDTLPGAN 307 C+ GT +T DGG GA DT PG + Sbjct: 20 CQQNGTFTFATSGDGGGGGGATDTPPGVD 48 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 22.6 bits (46), Expect = 5.5 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 136 NVRRECSFDTNNTRIPSERTTFGMSSISASFTQKFGV 246 NV+ + SFD + I R + I F FG+ Sbjct: 956 NVKNKISFDESTVEIMIRREYLELEPIGLVFVMFFGL 992 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 22.2 bits (45), Expect = 7.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 314 ELIVVVAVKDFEYF 273 +LI V VKDF YF Sbjct: 85 DLIKTVLVKDFSYF 98 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 22.2 bits (45), Expect = 7.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 314 ELIVVVAVKDFEYFD*HQ 261 ELI + VKDF++F H+ Sbjct: 89 ELIKQITVKDFDHFINHR 106 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.8 bits (44), Expect = 9.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 134 KMLDENVHLIQTIQEYQAKGQLL 202 KML+E+V +TI+EY+ +L Sbjct: 2517 KMLNESVDDSETIREYRRPRDVL 2539 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,483 Number of Sequences: 2352 Number of extensions: 7422 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32067225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -