BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K03 (491 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 3.2 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 3.2 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 3.2 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = -1 Query: 395 DISCIFFKFSSA----LSI*FSVD-AISRAAFIRSSLDFDPLCMCRPNDVILFIFT 243 +I C FF FSS+ LS+ F V + R + L +C R +++F T Sbjct: 189 EICCRFFTFSSSLCCFLSVWFVVAFTVERFIAVLYPLKRQTMCTVRRAKIVIFALT 244 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.8 bits (49), Expect = 3.2 Identities = 13/59 (22%), Positives = 26/59 (44%) Frame = +1 Query: 292 SKSNELLIKAAREMASTENQMESADENLKKMQLISVHIGYQYENIHKSAQVLSEIKEQI 468 S+ NE L + + + + +E + +S +G E IH+ L ++EQ+ Sbjct: 436 SEKNEALKRQEKLIDHIKTSRLGLEEQKRIKAELSQDVGTSKERIHELQSELDNVREQL 494 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 448,708 Number of Sequences: 2352 Number of extensions: 7735 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -