BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K03 (491 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3030|AAF57456.1| 105|Drosophila melanogaster CG18065-P... 75 5e-14 >AE013599-3030|AAF57456.1| 105|Drosophila melanogaster CG18065-PA, isoform A protein. Length = 105 Score = 74.9 bits (176), Expect = 5e-14 Identities = 35/89 (39%), Positives = 55/89 (61%) Frame = +1 Query: 217 KQRLAERVQVNMNNITSLGRHIQRGSKSNELLIKAAREMASTENQMESADENLKKMQLIS 396 K+RL RV N NN+ S+ R + RGSKSNE++ + + + + + +NL+KM LI Sbjct: 17 KKRLCVRVGENANNLGSVARQVVRGSKSNEIMHQTLKNFTQVDVVSDYSHQNLQKMTLIL 76 Query: 397 VHIGYQYENIHKSAQVLSEIKEQIMAMQK 483 H+GYQY+ + S L +KEQ+ AM++ Sbjct: 77 QHVGYQYDVMQDSVNHLDYLKEQVTAMER 105 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,769,033 Number of Sequences: 53049 Number of extensions: 333172 Number of successful extensions: 735 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1721789184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -