BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_K01 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) 150 5e-37 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 32 0.23 SB_49776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2) 31 0.53 SB_38861| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) 31 0.71 SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) 31 0.71 SB_29529| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) 31 0.71 SB_26305| Best HMM Match : Integrase_Zn (HMM E-Value=9.6) 31 0.71 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 30 1.2 SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) 29 1.6 SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) 29 2.2 SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) 29 2.2 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 29 2.2 SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29) 29 2.2 SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6) 29 2.2 SB_59388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_30646| Best HMM Match : CHASE3 (HMM E-Value=2.7) 29 2.2 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0) 29 2.8 SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.8 SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.8 SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.8 SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) 29 2.8 SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_15074| Best HMM Match : PID (HMM E-Value=0.00012) 28 5.0 SB_4982| Best HMM Match : 7tm_1 (HMM E-Value=1.9e-21) 28 5.0 SB_55854| Best HMM Match : NinE (HMM E-Value=2.1) 28 5.0 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097) 28 5.0 SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17) 27 6.6 SB_52277| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_42806| Best HMM Match : MORN (HMM E-Value=0) 27 6.6 SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_37908| Best HMM Match : Retrotrans_gag (HMM E-Value=0.067) 27 8.7 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 27 8.7 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 27 8.7 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 27 8.7 SB_34874| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_32265| Best HMM Match : Bim_N (HMM E-Value=1.5) 27 8.7 SB_29927| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_17780| Best HMM Match : TT_ORF2 (HMM E-Value=2.6) 27 8.7 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 27 8.7 SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) 27 8.7 >SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 768 Score = 150 bits (364), Expect = 5e-37 Identities = 67/90 (74%), Positives = 79/90 (87%) Frame = +2 Query: 26 MTNSKGYRRGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 205 MTN+KGYRRGTR +F+++FR G LSTY+K YKVGDIVD++ NGAVQKGMPHKVYHGK Sbjct: 423 MTNTKGYRRGTRYMFSKKFRHRGVEHLSTYLKCYKVGDIVDVKANGAVQKGMPHKVYHGK 482 Query: 206 TGRVYNVTAHALGVIVNKRVRGRILPKRIN 295 TGRVYNVT ALGV+VNK+V+G+IL KRIN Sbjct: 483 TGRVYNVTKRALGVVVNKQVKGKILAKRIN 512 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 32.3 bits (70), Expect = 0.23 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +1 Query: 235 RSRRDREQARPRQDPTETHQHPHRAREALQVQAGLPQARQGERK 366 R RR RE RQD +HP RAR A + G R E + Sbjct: 305 RGRRRRENKTRRQDRDSHGRHPGRARNAWDISTGSNVVRGAEHQ 348 >SB_49776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 32.3 bits (70), Expect = 0.23 Identities = 24/83 (28%), Positives = 35/83 (42%) Frame = +2 Query: 146 DIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRILPKRINIRIEHVKHSK 325 DI G G+ GMP + G+V ++ A GV++ R ++ I H HSK Sbjct: 102 DIEGTGSYNGGMPQEDLRNTIGQVADL--GAAGVVMWGNRRDENTSPQVCKHINHYIHSK 159 Query: 326 CRQDFLKRVKENERLLKEAKAAG 394 F+ R+K E K G Sbjct: 160 L-GPFIHRMKTTAEKCSELKCRG 181 >SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2) Length = 531 Score = 31.1 bits (67), Expect = 0.53 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 226 DRTRSRRDREQARPRQDPTETHQHPHRAREALQVQA 333 +RTR RDR+ R R D E + RAR+ V+A Sbjct: 218 ERTRDHRDRDFERSRHDRRERDREVERARDQKDVRA 253 >SB_38861| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) Length = 432 Score = 30.7 bits (66), Expect = 0.71 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -3 Query: 436 SLWRCRLSLQVNYFAGGFSFLQQP--FVLLDALEEVLP 329 S+W L V YFAGG F+ QP F+ LE LP Sbjct: 88 SVWMLASVLSVPYFAGGDKFIFQPAEFLCFFTLERPLP 125 >SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) Length = 565 Score = 30.7 bits (66), Expect = 0.71 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 338 FLKRVKENERLLKEAKAAGKVVNLKRQPA-PPKAAHIVSGAEKPVLLAPIP 487 F+KR + +R L+E A +NL ++PA P K + EKPV P P Sbjct: 272 FVKRTQRRQRELEEVADA---INLAKRPAQPEKPLKFLVKVEKPVPRPPTP 319 >SB_29529| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) Length = 269 Score = 30.7 bits (66), Expect = 0.71 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -3 Query: 436 SLWRCRLSLQVNYFAGGFSFLQQP--FVLLDALEEVLP 329 S+W L V YFAGG F+ QP F+ LE LP Sbjct: 88 SVWMLASVLSVPYFAGGDKFIFQPAEFLCFFTLERPLP 125 >SB_26305| Best HMM Match : Integrase_Zn (HMM E-Value=9.6) Length = 222 Score = 30.7 bits (66), Expect = 0.71 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 220 QCDRTRSRRDREQARPRQDPTETHQHPHRAREALQVQAGLP-QARQGERK 366 Q ++ S RD++ ARPRQ +T + ++ QA P Q RQ RK Sbjct: 74 QVNQAASPRDKQCARPRQPSRKTKASKPQDQDKRDKQAARPRQERQASRK 123 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 229 RTRSRRDREQARPRQDPTETHQHPH 303 RTR R R + P DPT T PH Sbjct: 124 RTRHRPTRRRHEPHTDPTRTRHEPH 148 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +1 Query: 226 DRTRSRRD--REQARPRQDPTETHQHPH 303 D TR+ D + Q RP DPT+T PH Sbjct: 150 DTTRTHTDPTQTQHRPNTDPTQTQHRPH 177 >SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) Length = 547 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 244 RDREQARPRQDPTETHQHPHRAREALQVQAGLPQA-RQGERK 366 +D++ ARPRQ +T + + ++A + PQA RQ RK Sbjct: 201 QDKQAARPRQASRKTSKSQDQDKQAASPKTSKPQAPRQASRK 242 >SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) Length = 622 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 290 INIRIEHVKHSKCRQDFLK-RVKENERLLKEAKAAGKVVNLKRQPAPPKAAH-IVSGAEK 463 IN+ I +SK QD+LK + K NER + ++ +KR+ A + +VS K Sbjct: 109 INVFITDEFYSKA-QDYLKEKAKGNERRISNQMTKTEIEAIKRKKWTLNAKNEVVSSGGK 167 Query: 464 PVL 472 PVL Sbjct: 168 PVL 170 >SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) Length = 324 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 290 INIRIEHVKHSKCRQDFLK-RVKENERLLKEAKAAGKVVNLKRQPAPPKAAH-IVSGAEK 463 IN+ I +SK QD+LK + K NER + ++ +KR+ A + +VS K Sbjct: 28 INVFITDEFYSKA-QDYLKEKAKGNERRISNQMTKTEIEAIKRKKWTLNAKNEVVSSGGK 86 Query: 464 PVL 472 PVL Sbjct: 87 PVL 89 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 226 DRTRSRRDREQARPRQDPTETHQHPHRAREALQVQAGLPQARQGER 363 D+ + ++ QARPRQ ++ P +A + Q +QG R Sbjct: 185 DKPQGKQAARQARPRQASRKSKARPRQASRKSKASKSKDQGKQGAR 230 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 220 QCDRTRSRRDRE-QARPRQDPTETHQHPHRAREALQVQAGLPQARQGER 363 Q + + ++D+E QARPRQ ++ P +A + Q +QG R Sbjct: 400 QDKQEQDKQDQEKQARPRQASRKSKARPTQASRKSKASKSKDQGKQGAR 448 >SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29) Length = 324 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 290 INIRIEHVKHSKCRQDFLK-RVKENERLLKEAKAAGKVVNLKRQPAPPKAAH-IVSGAEK 463 IN+ I +SK QD+LK + K NER + ++ +KR+ A + +VS K Sbjct: 28 INVFITDEFYSKA-QDYLKEKAKGNERRISNQMTKTEIEAIKRKKWTLNAKNEVVSSGGK 86 Query: 464 PVL 472 PVL Sbjct: 87 PVL 89 >SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6) Length = 305 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 398 VVNLKRQPAPPKAAHIVSGAEKPVLLAPIPYE 493 +VN + PP A + ++ ++PVL P+P++ Sbjct: 129 LVNKSKAETPPPAYYTITSNQEPVLNMPVPWQ 160 >SB_59388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 290 INIRIEHVKHSKCRQDFLK-RVKENERLLKEAKAAGKVVNLKRQPAPPKAAH-IVSGAEK 463 IN+ I +SK QD+LK + K NER + ++ +KR+ A + +VS K Sbjct: 74 INVFITDEFYSKA-QDYLKEKAKGNERRISNQMTKTEIEAIKRKKWTLNAKNEVVSSGGK 132 Query: 464 PVL 472 PVL Sbjct: 133 PVL 135 >SB_30646| Best HMM Match : CHASE3 (HMM E-Value=2.7) Length = 130 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 290 INIRIEHVKHSKCRQDFLK-RVKENERLLKEAKAAGKVVNLKRQPAPPKAAH-IVSGAEK 463 IN+ I +SK QD+LK + K NER + ++ +KR+ A + +VS K Sbjct: 39 INVFITDEFYSKA-QDYLKEKAKGNERRISNQMTKTEIEAIKRKKWTLNAKNEVVSSGGK 97 Query: 464 PVL 472 PVL Sbjct: 98 PVL 100 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 170 QKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRILPKRINIRIEH 310 ++G PH+ + G TGR A+ + +K + ++L +R NI + H Sbjct: 108 KEGKPHENHSGLTGR-----RGAMRALASKDINAQLLKERFNINMPH 149 >SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0) Length = 730 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 253 HDHAESVCGHIVNTPCLTVVYFVWHTLLYSAIAPNVNDVSHFVH 122 H ++ GHIVNT + ++Y V T + I + H V+ Sbjct: 477 HIVTTTIIGHIVNTTTIIIIYIVNTTTIIIHIVNTTTIIVHIVN 520 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 226 HIVNTPCLTVVYFVWHTLLYSAIAPNVNDVSHFVH 122 HIVNT + ++Y V T + S I H VH Sbjct: 517 HIVNTTTIIIIYIVNTTTIISHIVNTTTHHHHIVH 551 >SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1020 Score = 28.7 bits (61), Expect = 2.8 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +2 Query: 74 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 247 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 482 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAE 541 Query: 248 IVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRVKENER 367 V + R R R+ IEH S CR KR K +R Sbjct: 542 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 581 >SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1387 Score = 28.7 bits (61), Expect = 2.8 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +2 Query: 74 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 247 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 719 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAE 778 Query: 248 IVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRVKENER 367 V + R R R+ IEH S CR KR K +R Sbjct: 779 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 818 >SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1623 Score = 28.7 bits (61), Expect = 2.8 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +2 Query: 74 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 247 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 1270 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLGYKELHEEMGHLGAE 1329 Query: 248 IVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRVKENER 367 V + R R R+ IEH S CR KR K +R Sbjct: 1330 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 1369 >SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) Length = 440 Score = 28.7 bits (61), Expect = 2.8 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +2 Query: 74 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 247 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 166 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLGYKELHEEMGHLGAE 225 Query: 248 IVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRVKENER 367 V + R R R+ IEH S CR KR K +R Sbjct: 226 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 265 >SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1984 Score = 28.7 bits (61), Expect = 2.8 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = +2 Query: 74 RRFRTHGTIPLSTYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGV 247 R+ T T + + K ++G DI+ R +Q +P K++H ++ H Sbjct: 1054 RKKETPETKAMLRHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAE 1113 Query: 248 IVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRVKENER 367 V + R R R+ IEH S CR KR K +R Sbjct: 1114 RVLQLARDRFFWPRMQQDIEHYVTSVCRCIKQKRPKHAQR 1153 >SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1387 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 221 CKHALSYRGILCVAYPFVQRHCP*CQRCLPLCTLSC 114 C H+ + G C Y R CP + C CT C Sbjct: 823 CDHSHYFNGAECAPYKISHRPCP--EACAKRCTDDC 856 >SB_15074| Best HMM Match : PID (HMM E-Value=0.00012) Length = 1153 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 33 TPRVIVVVPGTCSPEDSAHMELFHFP 110 TP + G C+ DS + E+FHFP Sbjct: 328 TPGSSPQINGFCTSTDSQYAEIFHFP 353 >SB_4982| Best HMM Match : 7tm_1 (HMM E-Value=1.9e-21) Length = 217 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 74 GRTSPWYHDDNPWSLSYFSLV 12 G PW D PW L+YF+ V Sbjct: 165 GCIEPWPKSDFPWHLAYFAFV 185 >SB_55854| Best HMM Match : NinE (HMM E-Value=2.1) Length = 271 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 284 KRINIRIEH-VKHSKCRQDFLKRVKENERLLKEAKA 388 +RI I+H ++ K +QDF+ +KE RL +E+++ Sbjct: 39 ERIQSCIDHKLEERKIKQDFVTLIKERNRLGRESRS 74 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 445 NMRSLWRCRLSLQVNYFAGGFSFLQQPFVLLDALEEVLPA--LGVLHVLDAD 296 N+R LW CR SL S L + ++ + + +V P L L VLD + Sbjct: 757 NLRMLWMCRCSLSDLDGISSLSSLAELYLAFNDISDVSPVSMLDNLQVLDLE 808 >SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097) Length = 812 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGER 363 C+ C R R R Q +P+Q P H ++A Q+ + + +Q R Sbjct: 292 CIDCHRVNRRSRRPQRQPQQRSPQAPTVHANQAEPIAQISSLQGETKQDTR 342 >SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1243 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGER 363 C+ C R R R Q +P+Q P H ++A Q+ + + +Q R Sbjct: 510 CIDCHRVNRRSRRPQRQPQQRSPQAPTVHANQAEPIAQISSLHGETKQDTR 560 >SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17) Length = 1590 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGER 363 C+ C R R R Q +P+Q P H ++A Q+ + + +Q R Sbjct: 292 CIDCHRVNRRSRRPQRQPQQRSPQAPTVHANQAEPIAQISSLHGETKQDTR 342 >SB_52277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.6 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 266 RGRILPKRINIRIEHVKHSKCRQDFLKRVKENERLLKEAKAAGKVVNLKRQPAPPK 433 R R+ KR+ +RI+H+ F KR++ N L+ +V+ +P P K Sbjct: 99 RLRVRTKRVQVRIDHL------GIFTKRLRVNTERLRSRTEPQRVITSAYEPVPNK 148 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/58 (25%), Positives = 31/58 (53%) Frame = +2 Query: 323 KCRQDFLKRVKENERLLKEAKAAGKVVNLKRQPAPPKAAHIVSGAEKPVLLAPIPYEF 496 K R + ++ + +RLL+++++ K L++ P P A + + E P+ A P+ F Sbjct: 1549 KARDNRVRLKDQEKRLLRQSESEKKHAALEQPPTP--APQVETQPETPIHQAASPFVF 1604 >SB_42806| Best HMM Match : MORN (HMM E-Value=0) Length = 778 Score = 27.5 bits (58), Expect = 6.6 Identities = 24/92 (26%), Positives = 39/92 (42%) Frame = +2 Query: 188 KVYHGKTGRVYNVTAHALGVIVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRVKENER 367 K Y KT +Y + A+A + + G P R ++R +H + +K E Sbjct: 532 KKYIPKTWDIY-MDANAPSRSMEESQEGTDSPIR-SVRSQHGARESPDKPLDSPIKSREG 589 Query: 368 LLKEAKAAGKVVNLKRQPAPPKAAHIVSGAEK 463 KEA AGKV + Q + +VS ++ Sbjct: 590 PNKEASLAGKVPEVSPQEGARRTVSLVSAGKE 621 >SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1552 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGER 363 C+ C R R R Q +P+Q P H ++A Q+ + + +Q R Sbjct: 270 CIDCHRVNRRARRPQRQPQQRSPQAPTVHANQAEPIAQISSLHGETKQDTR 320 >SB_37908| Best HMM Match : Retrotrans_gag (HMM E-Value=0.067) Length = 449 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGER 363 C+ C R R R Q +P+Q P H +A Q+ + + +Q R Sbjct: 292 CIDCHRVNRRSRRPQRQPQQRSPQAPTVHATQAEPIAQISSPHGETKQDTR 342 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +2 Query: 293 NIRIEHVKHSKCRQDFLKRVKENERLLKEAKAAGKV 400 N R+++ ++ K R++ RV +NE LLK+ K KV Sbjct: 32 NDRLDN-ENQKLRKELADRVDQNEILLKQVKELEKV 66 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 27.1 bits (57), Expect = 8.7 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = +2 Query: 245 VIVNKRVRGRILPKRINIRIEHVKHSKCRQDFLKRV---KENERLLKEAKAAGKVVNLKR 415 +I R R KR+ ++K D R+ KENE K ++A +++NL+ Sbjct: 1538 IIEKSNDRDRENAKRMEEENINLKRRVAEMDINNRINSEKENELQSKLSQAHEQIINLEN 1597 Query: 416 QPAPPKAAHIVS 451 +P A +VS Sbjct: 1598 RPQLESAISMVS 1609 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 235 RSRRDREQARPRQDPTETHQHPHRAREALQ 324 RSRR+ + A+PR +PT + PH++ + Q Sbjct: 98 RSRRETQLAQPR-NPTSPAEKPHQSSKETQ 126 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 235 RSRRDREQARPRQDPTETHQHPHR-AREALQVQAGLP 342 RSRR+ + A+PR +PT + PH+ +RE VQ P Sbjct: 201 RSRRETQLAQPR-NPTGPAEKPHQYSRETPPVQPRNP 236 >SB_34874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +1 Query: 220 QCDRTRSRRDREQARPRQDPTETHQHPHRAREALQVQAGLPQARQ 354 +C+R +S E + +Q+ T+ HQ A A+++Q L A + Sbjct: 121 KCERAKSLPIEESVQLQQEQTKHHQELVAAHAAIRLQEQLKNAEK 165 >SB_32265| Best HMM Match : Bim_N (HMM E-Value=1.5) Length = 235 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGER 363 C+ C R R R Q +P+Q P H ++A Q+ + + +Q R Sbjct: 49 CIDCHRVNRRSRRPQRQPQQRSPQAPTVHVNQAEPIAQISSLHGETKQDTR 99 >SB_29927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 820 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +1 Query: 214 CLQCDRTRSRRDREQARPRQ-DPTETHQHPHRAREALQVQAGLPQARQGERK 366 C+ C R R R Q +P+Q P H +A + + Q +G R+ Sbjct: 117 CIDCHRVNRRSRRPQRQPQQRSPQAPTVHATQAEPIAHISSLHGQTSEGNRR 168 >SB_17780| Best HMM Match : TT_ORF2 (HMM E-Value=2.6) Length = 310 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 175 LLYSAIAPNVNDVSHFVHFHVRGKWNSS 92 L Y +I V FVHFH+ W ++ Sbjct: 283 LRYQSIPEEVKAFERFVHFHIAEPWQAT 310 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +2 Query: 293 NIRIEHVKHSKCRQDFLKRVKENERLLKEAKAAGKV 400 N R+++ ++ K R++ RV +NE LLK+ K KV Sbjct: 769 NDRLDN-ENQKLRKELADRVDQNEILLKQVKELEKV 803 >SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) Length = 1019 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +1 Query: 235 RSRRDREQARPRQDPTETHQHPHRAREALQVQAGLPQARQGERKAVEG 378 R+R + R PTE+ HP+ +R L ++G Q++ E++ G Sbjct: 789 RNRYSESRNDSRYIPTESRSHPNESRGHLS-ESGSVQSKDKEKEVSTG 835 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,739,192 Number of Sequences: 59808 Number of extensions: 359460 Number of successful extensions: 1514 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1508 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -