BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J24 (530 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 188 2e-50 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 5.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 5.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 5.9 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 7.9 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 7.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.9 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 188 bits (459), Expect = 2e-50 Identities = 88/88 (100%), Positives = 88/88 (100%) Frame = +1 Query: 265 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 444 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 445 DVDIRKDLYANTVLSGGTTMYPGIADRM 528 DVDIRKDLYANTVLSGGTTMYPGIADRM Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRM 88 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 5.9 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 376 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 486 + +FLG+ + +YN + D + KDL+ +L Sbjct: 328 ETTFLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQIL 364 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 5.9 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = +3 Query: 489 WWYHHVPWYC 518 WW H + W C Sbjct: 526 WWSHVLGWLC 535 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 5.9 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = +3 Query: 489 WWYHHVPWYC 518 WW H + W C Sbjct: 579 WWSHVLGWLC 588 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/40 (22%), Positives = 18/40 (45%) Frame = +3 Query: 279 CLQQLPREVLRTPRRSSHHNRKRKVPLPRGSLPALVLGYG 398 C++ P + RR H +P+P+ + ++ YG Sbjct: 32 CVRVSPVITIEPRRRKFHKPITLTIPVPQAANKGMINQYG 71 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 410 MPQASIPKNEGWKRASGQRNLSFPIVMT 327 + Q IP + +G+RN+ PIV + Sbjct: 165 LKQVKIPHDIAINSTTGKRNVVTPIVQS 192 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 67 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 165 +H + Y GY P + D A + T+ MK+ Sbjct: 187 NHQLISYAGYKNPDGTIIGDPANIEFTELCMKL 219 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,815 Number of Sequences: 438 Number of extensions: 3448 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -