BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J23 (540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) 231 4e-61 SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) 54 7e-08 SB_47353| Best HMM Match : Neur_chan_memb (HMM E-Value=3.2) 32 0.34 SB_30690| Best HMM Match : Neur_chan_memb (HMM E-Value=4.3e-09) 32 0.34 SB_38738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 29 2.4 SB_48459| Best HMM Match : B12-binding_2 (HMM E-Value=3.3) 29 3.2 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 27 7.4 SB_42525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_37037| Best HMM Match : PSI (HMM E-Value=0.061) 27 9.8 >SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) Length = 192 Score = 231 bits (564), Expect = 4e-61 Identities = 108/158 (68%), Positives = 128/158 (81%) Frame = +1 Query: 67 PIRKKRKYELGRPAANTKLGPQRIHLVRSRGGNTKYRALRLDTGNFAWGSECSTRKTRII 246 P+R KRK+ELGRP ANTK+G +RIH VR+RGGN K+RA RLDT NF+WGSE TRK RII Sbjct: 4 PLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFSWGSESCTRKARII 63 Query: 247 DVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINK 426 DVVYNASNNELVRTKTLVKN IV VD+TPFRQWYE+HY +P+GRKK + TE E+ I+NK Sbjct: 64 DVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKTKQPTEEEQEILNK 123 Query: 427 KRSQKTAKKYLSRQRLSKVEGGLEEQFHTGRLLACVAS 540 KRS +K +R+ +KV G+EEQF TGRL ACV+S Sbjct: 124 KRSNHCTRKLEARKANAKVAPGMEEQFVTGRLYACVSS 161 >SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) Length = 147 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/77 (31%), Positives = 46/77 (59%) Frame = +1 Query: 127 PQRIHLVRSRGGNTKYRALRLDTGNFAWGSECSTRKTRIIDVVYNASNNELVRTKTLVKN 306 P++I ++ GG+TK +ALR++ G + S+ + I+ V+++ +N E + +VK Sbjct: 37 PEKIKERKAYGGHTKIKALRVNKGVYTLKSQGVEVEAPILSVMHSFANKEHIERNVIVKG 96 Query: 307 AIVVVDATPFRQWYESH 357 +IV VD PF W++ + Sbjct: 97 SIVQVDNKPFEDWFQEY 113 >SB_47353| Best HMM Match : Neur_chan_memb (HMM E-Value=3.2) Length = 133 Score = 31.9 bits (69), Expect = 0.34 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 319 VDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINKKRSQKTAKKYLSRQRLSKVE 486 + A R+W+E K+ A+L +I+ + +K AK+Y+ +QRL +E Sbjct: 53 IKANNARKWWEKEMRANQTAKELARLASWRTWVISGETVEKKAKQYVFKQRLQDIE 108 >SB_30690| Best HMM Match : Neur_chan_memb (HMM E-Value=4.3e-09) Length = 193 Score = 31.9 bits (69), Expect = 0.34 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 319 VDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINKKRSQKTAKKYLSRQRLSKVE 486 + A R+W+E K+ A+L +I+ + +K AK+Y+ +QRL +E Sbjct: 87 IKANNARKWWEKEMRANQTAKELARLASWRTWVISGETVEKKAKQYVFKQRLQDIE 142 >SB_38738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 424 KKRSQKTAKKYLSRQRLSKVEGGLEE 501 K+R QK K Y RQR +++ LEE Sbjct: 15 KRRKQKATKSYAERQRRTRINKSLEE 40 >SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 226 TRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFR 339 T++ +I D++ N N VR +TL+ NA +++D F+ Sbjct: 18 TKRKKIADILSNEIRN--VRERTLILNAALIIDICVFK 53 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 29.1 bits (62), Expect = 2.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 43 RATGGKRAPIRKKRKYELGRPAANTKLGP 129 R GG R P+++ +E +P+ N + GP Sbjct: 769 RRGGGSRVPVKRSSSFENRKPSPNRRRGP 797 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 334 FRQWYESHYLLPLGRKKGAKLTEAEEAIINKKRSQKTAKKYLSRQRLSKVE 486 F Q H++ +KKG + + A+ +R + AK+ LS Q ++VE Sbjct: 930 FDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVE 980 >SB_48459| Best HMM Match : B12-binding_2 (HMM E-Value=3.3) Length = 115 Score = 28.7 bits (61), Expect = 3.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 2 HEGWVSVVIIGIRGGLRAANVRPF 73 H+GW VIIG+ G + + RPF Sbjct: 31 HKGWGESVIIGVAAGGQEISTRPF 54 >SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) Length = 2007 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 311 LSWWMPHLSGSGMKATTCCHSEGRKVPSSLRL 406 L+ WM HL + CH+EGR + L L Sbjct: 1881 LTIWMKHLENWPLHMPIVCHAEGRTTAAILLL 1912 >SB_42525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -1 Query: 153 GSD*VDALGTKLSVGSRAT*LILPLLTNGRTFAARSPPLMPMITTD 16 GS +D L +L+ G R T + L +GR + SPPL+ I D Sbjct: 15 GSGDLDYLERQLNCGLRTT--AVTWLHSGRVVSRNSPPLLGHIVND 58 >SB_37037| Best HMM Match : PSI (HMM E-Value=0.061) Length = 284 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 236 LVLLMLFIMPLTMNWCVPKPW*RMLLSW 319 LVLL+L ++ LT CV W + SW Sbjct: 213 LVLLLLCVVGLTTTVCVANEWHFKIYSW 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,424,493 Number of Sequences: 59808 Number of extensions: 431238 Number of successful extensions: 984 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -