BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J19 (403 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0084 - 10477880-10477897,10477940-10478002,10479523-104795... 29 1.4 04_03_0286 + 13915705-13915984,13916478-13917062,13918188-139186... 29 1.8 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 28 3.2 12_01_0513 + 4059586-4059620,4060155-4060365,4060470-4060724,406... 27 5.6 04_03_0643 + 18328807-18331969,18332560-18332627 27 5.6 06_01_1135 - 9379361-9381018,9381356-9381665,9381811-9382764 27 7.3 >10_06_0084 - 10477880-10477897,10477940-10478002,10479523-10479575, 10479774-10480589,10480889-10480998,10481338-10482068 Length = 596 Score = 29.1 bits (62), Expect = 1.4 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 227 YVSSVSIIVLM*L*YFNTCVRVQGSKYTDRFVVRYGTATSMY 352 Y+SS+ II L + +T VR+ G TD+ VV Y S Y Sbjct: 486 YLSSILIIKLACAGHSSTAVRIFGLLTTDKNVVTYTALMSAY 527 >04_03_0286 + 13915705-13915984,13916478-13917062,13918188-13918661, 13918963-13920208,13920282-13920297 Length = 866 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = +1 Query: 94 ACVCQDNTCTDGYY---LAYVCVCVG 162 AC+ + + C DGY+ L Y C+C G Sbjct: 247 ACISEHSKCMDGYFAPILGYNCLCDG 272 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 27.9 bits (59), Expect = 3.2 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 135 VVPVGTRIVLTHARTNTLQLVVF 67 VVP G IV+T +R +TLQ+V F Sbjct: 404 VVPSGHPIVVTSSRDSTLQIVCF 426 >12_01_0513 + 4059586-4059620,4060155-4060365,4060470-4060724, 4060801-4060865,4061120-4061194,4061440-4061575, 4061661-4061753,4061838-4061983,4062074-4062174, 4062259-4062434,4063823-4063900,4063991-4064199, 4064286-4064378,4064888-4064971,4065405-4065506, 4065591-4065678,4065756-4065809,4065869-4066075, 4066970-4067026,4067171-4067225,4067737-4067813, 4067941-4068007,4068383-4068444,4068541-4068603, 4068702-4068830 Length = 905 Score = 27.1 bits (57), Expect = 5.6 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Frame = -3 Query: 188 TVSMHA----HNTPTHTHTY 141 TV++H HN+PTHTH+Y Sbjct: 679 TVNVHMTQTPHNSPTHTHSY 698 >04_03_0643 + 18328807-18331969,18332560-18332627 Length = 1076 Score = 27.1 bits (57), Expect = 5.6 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +3 Query: 261 NCNILTRACVSKARNILTGLLF---VTVQRHLCTVL*ITYRFYM 383 NC LT CVS+A NI T +F TV C L F+M Sbjct: 884 NCGSLTSICVSEASNIHTVGVFSSLSTVTISFCNALLSLDEFFM 927 >06_01_1135 - 9379361-9381018,9381356-9381665,9381811-9382764 Length = 973 Score = 26.6 bits (56), Expect = 7.3 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -1 Query: 376 NRYVIYNTVHRCRCTVTNNKPVSIFRAL 293 ++Y +YN H +C++ ++ +SI R L Sbjct: 544 SKYSVYNFTHMLKCSMPDDLNLSIIRVL 571 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,364,775 Number of Sequences: 37544 Number of extensions: 151825 Number of successful extensions: 314 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -