BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J16 (520 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces po... 26 2.9 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 26 3.9 SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce... 26 3.9 SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosacch... 26 3.9 SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|c... 25 6.8 SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe... 25 9.0 SPBC11B10.05c |rsp1||random septum position protein Rsp1|Schizos... 25 9.0 >SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 26.2 bits (55), Expect = 2.9 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 121 TLQHLGIFI-DESVIFNKLNISKLSYCKPNSTI 216 TLQ I +ES +FN++ +S YC +ST+ Sbjct: 247 TLQQYSIVAQEESNLFNQIVLSNSKYCLAHSTL 279 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 25.8 bits (54), Expect = 3.9 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 112 RPLTLQHLGIFIDESVIFNKLNISKL 189 +P+TLQHL + I S I N N SKL Sbjct: 1614 KPITLQHLSLII--SGILNYTNQSKL 1637 >SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1242 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 373 QLSTFMTSSFCQTSVNKYTFVYHQISSNS 459 +L +SSF Q S N Y+++Y + S+S Sbjct: 533 KLQGIFSSSFQQVSNNMYSWIYDHVFSSS 561 >SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 25.8 bits (54), Expect = 3.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 224 IQLCIILYKLNEVCRYEKIFGLNSILNKNYTYYINNS 334 + CI LYK E C + FG+ + L ++ N S Sbjct: 325 VDRCIELYKYCEKCGIKSAFGIGTNLTSDFQKVSNPS 361 >SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 157 VIFNKLNISKLSYCKPNSTIKKNTTL 234 ++ ++L I SYC PN I K T L Sbjct: 1513 IVVSELLIIFKSYCMPNVAISKETLL 1538 >SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 527 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 299 GWNSNQIFFRICTLHLICIELYKVVFFFIVEFG 201 G N IF+ TL +IC Y+V+ ++ G Sbjct: 229 GENERYIFWDSSTLRIICSHTYQVLLKHLITKG 261 >SPBC11B10.05c |rsp1||random septum position protein Rsp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 494 Score = 24.6 bits (51), Expect = 9.0 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 76 SRPEIPTKTPRGRPLTLQHLGIFIDESVIFNKLNISKLSYCKPNSTIKKNTTLYN 240 S+PEIP + P +PL + L S+ N+ S+L+ + N+T Y+ Sbjct: 302 SKPEIPFRHPTSKPLPPKPLSRSKSSSLSRNQTR-SQLNDLSAENDSTSNSTEYD 355 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,030,103 Number of Sequences: 5004 Number of extensions: 38638 Number of successful extensions: 74 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -