BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J16 (520 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0348 - 28162681-28162849,28162946-28163154 29 2.2 02_05_0563 + 29998291-29998753,29999256-29999468,29999550-299996... 27 6.8 >02_05_0348 - 28162681-28162849,28162946-28163154 Length = 125 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 480 HYFTGLYRVGRYLVVNKSIFVYASLTK**RHECR 379 HY + GR L NK IF+Y T ECR Sbjct: 48 HYLDACFLCGRMLAGNKDIFMYRGDTPFCSEECR 81 >02_05_0563 + 29998291-29998753,29999256-29999468,29999550-29999667, 30000227-30000355,30000438-30000810,30000890-30001147, 30001192-30001227 Length = 529 Score = 27.5 bits (58), Expect = 6.8 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 260 VCRYEKIFGLNSILNKNYTYYINNSYSLIH*IFMKLIISYRHS*RHHFVKLA*TNILL-- 433 +C E L+ LNK + N +++ + LI +RH H VK NILL Sbjct: 301 ICMKECARSLSEYLNKRQELGLQNEHNMFAQLIDSLIFMHRHGIVHRDVKPG--NILLEE 358 Query: 434 -FTTK 445 FT K Sbjct: 359 NFTVK 363 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,826,376 Number of Sequences: 37544 Number of extensions: 201823 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -