BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J16 (520 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 25 1.5 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 8.1 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 25.0 bits (52), Expect = 1.5 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 281 IFFRICTLHLICIELYKVVFFFIVEFGLQ*DNLLI 177 I F +C L + I + + + I+E+ ++ NLL+ Sbjct: 318 IVFLLCNLPAMMINIVEAFYSLIIEYMVKVSNLLV 352 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.6 bits (46), Expect = 8.1 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 Query: 56 HWHGARHSVPPYL 18 HWHG PY+ Sbjct: 140 HWHGLHQRATPYM 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,258 Number of Sequences: 2352 Number of extensions: 9704 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -