BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J15 (564 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q16UN3 Cluster: Putative uncharacterized protein; n=1; ... 33 6.1 UniRef50_A2Q836 Cluster: Similarity to hypothetical protein enco... 32 8.1 >UniRef50_Q16UN3 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 364 Score = 32.7 bits (71), Expect = 6.1 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -1 Query: 330 IN*STKNYFFFCIPFITHVHHIKHIISLYYFSVCIIIMELYNVSGLLLCASLFFMVLL 157 IN T NYF C F H+ HI ++ + +V + +S +LL + FF+ LL Sbjct: 221 INFITFNYFNHCSCFSFHLAHISLLLLFTFHTVAFAFLRFLRISLVLL--NFFFLYLL 276 >UniRef50_A2Q836 Cluster: Similarity to hypothetical protein encoded by An12g09280 - Aspergillus niger; n=1; Aspergillus niger|Rep: Similarity to hypothetical protein encoded by An12g09280 - Aspergillus niger - Aspergillus niger Length = 260 Score = 32.3 bits (70), Expect = 8.1 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -1 Query: 489 NHHISSNKNDYYC*RK*RCK*GTRGCHGRGVVQSR-SRAPLAPTLET*ILHN 337 N HI+ N++ + R+ CK + G G VQ R RAP P T +LH+ Sbjct: 85 NTHIAKNRSSFSSYRRAPCKIANQRVLGVGTVQLRVQRAPDDPRTNTLVLHD 136 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,996,893 Number of Sequences: 1657284 Number of extensions: 8702041 Number of successful extensions: 21485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21468 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37904934977 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -