BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J11 (246 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 142 5e-35 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 142 5e-35 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 138 8e-34 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 113 3e-26 SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) 84 2e-17 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-12 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 65 7e-12 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 65 1e-11 SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) 64 2e-11 SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) 64 2e-11 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-11 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 63 3e-11 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 63 3e-11 SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) 63 3e-11 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 63 3e-11 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-10 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 54 2e-08 SB_16885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-07 SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) 45 1e-05 SB_23746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) 31 0.14 SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.14 SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_2876| Best HMM Match : Peptidase_C2 (HMM E-Value=2.8) 29 0.58 SB_4950| Best HMM Match : ResIII (HMM E-Value=1.4) 29 0.77 SB_4866| Best HMM Match : DUF1509 (HMM E-Value=3.8) 28 1.0 SB_43900| Best HMM Match : ResIII (HMM E-Value=0.53) 28 1.0 SB_30086| Best HMM Match : LIM (HMM E-Value=0.5) 28 1.0 SB_56953| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) 28 1.3 SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) 28 1.3 SB_52418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_44150| Best HMM Match : LIM (HMM E-Value=0.3) 28 1.3 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 1.3 SB_37605| Best HMM Match : LIM (HMM E-Value=2.4) 28 1.3 SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) 28 1.3 SB_29109| Best HMM Match : C1_1 (HMM E-Value=3.6) 28 1.3 SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_22252| Best HMM Match : C1_1 (HMM E-Value=2.6) 28 1.3 SB_21218| Best HMM Match : C1_1 (HMM E-Value=3.6) 28 1.3 SB_19129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) 28 1.3 SB_13016| Best HMM Match : ResIII (HMM E-Value=0.62) 28 1.3 SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_4092| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_59009| Best HMM Match : DEAD (HMM E-Value=0.87) 28 1.3 SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) 28 1.3 SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) 28 1.3 SB_52039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_46105| Best HMM Match : C1_1 (HMM E-Value=3.6) 28 1.3 SB_45980| Best HMM Match : C1_3 (HMM E-Value=4.6) 28 1.3 SB_44861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_44503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_43547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 28 1.3 SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_30288| Best HMM Match : P19Arf_N (HMM E-Value=6.8) 28 1.3 SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 1.3 SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_24617| Best HMM Match : C1_1 (HMM E-Value=2.6) 28 1.3 SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) 28 1.3 SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) 28 1.3 SB_3379| Best HMM Match : NHase_beta (HMM E-Value=2.8) 28 1.3 SB_2283| Best HMM Match : LIM (HMM E-Value=1.4) 28 1.3 SB_53256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_48293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_48274| Best HMM Match : LIM (HMM E-Value=0.38) 27 1.8 SB_44046| Best HMM Match : P19Arf_N (HMM E-Value=5.5) 27 1.8 SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) 27 1.8 SB_32881| Best HMM Match : DUF75 (HMM E-Value=1.7) 27 1.8 SB_30838| Best HMM Match : ResIII (HMM E-Value=0.13) 27 1.8 SB_28107| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) 27 1.8 SB_24572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_21028| Best HMM Match : LIM (HMM E-Value=0.44) 27 1.8 SB_18996| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) 27 1.8 SB_16974| Best HMM Match : LIM (HMM E-Value=0.38) 27 1.8 SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_12073| Best HMM Match : LIM (HMM E-Value=0.49) 27 1.8 SB_5789| Best HMM Match : LIM (HMM E-Value=0.44) 27 1.8 SB_2879| Best HMM Match : zf-C4_Topoisom (HMM E-Value=2) 27 1.8 SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) 27 1.8 SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) 27 1.8 SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_44063| Best HMM Match : LIM (HMM E-Value=0.85) 27 1.8 SB_41732| Best HMM Match : LIM (HMM E-Value=0.84) 27 1.8 SB_38051| Best HMM Match : LIM (HMM E-Value=0.34) 27 1.8 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 27 1.8 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) 27 1.8 SB_16256| Best HMM Match : LIM (HMM E-Value=0.39) 27 1.8 SB_15851| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) 27 1.8 SB_12984| Best HMM Match : zf-C4_Topoisom (HMM E-Value=4.6) 27 1.8 SB_12490| Best HMM Match : DEAD (HMM E-Value=1.6) 27 1.8 SB_10610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_6355| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_5118| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) 27 1.8 SB_3087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_40687| Best HMM Match : PADR1 (HMM E-Value=0.23) 27 2.3 SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_27760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_24924| Best HMM Match : WHEP-TRS (HMM E-Value=1.1) 27 2.3 SB_16594| Best HMM Match : DUF1265 (HMM E-Value=2.6) 27 2.3 SB_15299| Best HMM Match : LIM (HMM E-Value=0.44) 27 2.3 SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) 27 2.3 SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) 27 2.3 SB_25592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 27 2.3 SB_6028| Best HMM Match : LIM (HMM E-Value=0.22) 27 2.3 SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 27 3.1 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 27 3.1 SB_41935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_8850| Best HMM Match : LIM (HMM E-Value=0.51) 27 3.1 SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) 26 4.1 SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_43440| Best HMM Match : PADR1 (HMM E-Value=0.45) 26 4.1 SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) 26 4.1 SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.1 SB_1571| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-16) 26 4.1 SB_58744| Best HMM Match : ResIII (HMM E-Value=0.14) 26 4.1 SB_40444| Best HMM Match : LIM (HMM E-Value=3.4) 26 4.1 SB_27544| Best HMM Match : ResIII (HMM E-Value=0.14) 26 4.1 SB_51277| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_42507| Best HMM Match : ResIII (HMM E-Value=0.75) 26 5.4 SB_56648| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.92) 25 7.1 SB_43151| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 25 7.1 SB_13843| Best HMM Match : PADR1 (HMM E-Value=2) 25 7.1 SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_50233| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_20194| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_15232| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 SB_57683| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 SB_52907| Best HMM Match : RVT_1 (HMM E-Value=2.4e-17) 25 9.4 SB_38724| Best HMM Match : DUF1684 (HMM E-Value=2.2) 25 9.4 SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 SB_23236| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 SB_5381| Best HMM Match : PAN (HMM E-Value=7.2e-05) 25 9.4 SB_50667| Best HMM Match : LIM (HMM E-Value=0.95) 25 9.4 SB_39546| Best HMM Match : FCH (HMM E-Value=8e-13) 25 9.4 SB_26900| Best HMM Match : LIM (HMM E-Value=0.63) 25 9.4 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 25 9.4 SB_13616| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 142 bits (343), Expect = 5e-35 Identities = 65/67 (97%), Positives = 66/67 (98%) Frame = +1 Query: 46 TCLRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAK 225 TCLRFPGQLNADLRKLAVNMVPFPRLHFF+ GFAPLTSRGSQQYRALTVPELTQQMFDAK Sbjct: 238 TCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAK 297 Query: 226 NMMAACD 246 NMMAACD Sbjct: 298 NMMAACD 304 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 142 bits (343), Expect = 5e-35 Identities = 65/67 (97%), Positives = 66/67 (98%) Frame = +1 Query: 46 TCLRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAK 225 TCLRFPGQLNADLRKLAVNMVPFPRLHFF+ GFAPLTSRGSQQYRALTVPELTQQMFDAK Sbjct: 238 TCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAK 297 Query: 226 NMMAACD 246 NMMAACD Sbjct: 298 NMMAACD 304 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 138 bits (333), Expect = 8e-34 Identities = 64/67 (95%), Positives = 65/67 (97%) Frame = +1 Query: 46 TCLRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAK 225 TCLRFPGQLNADLRKLAVNMVPFPRL FF+ GFAPLTSRGSQQYRALTVPELTQQMFDAK Sbjct: 183 TCLRFPGQLNADLRKLAVNMVPFPRLPFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAK 242 Query: 226 NMMAACD 246 NMMAACD Sbjct: 243 NMMAACD 249 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 113 bits (271), Expect = 3e-26 Identities = 50/67 (74%), Positives = 58/67 (86%) Frame = +1 Query: 46 TCLRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAK 225 TCLRFPGQLNADLRKLAVNM+P+PRLHFF+ GFAPLTSR YRALTV +LTQ +FD K Sbjct: 143 TCLRFPGQLNADLRKLAVNMIPYPRLHFFMPGFAPLTSRECVSYRALTVADLTQAIFDNK 202 Query: 226 NMMAACD 246 N++ AC+ Sbjct: 203 NLLIACN 209 >SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) Length = 271 Score = 83.8 bits (198), Expect = 2e-17 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +1 Query: 103 MVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACD 246 MVPFPRLHFF+ GFAPL SR +QQY+ ++V ELTQQMFDA+NMM ACD Sbjct: 1 MVPFPRLHFFMPGFAPLASRANQQYQNVSVEELTQQMFDARNMMTACD 48 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 65.7 bits (153), Expect = 5e-12 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV ++T FD N Sbjct: 1153 LRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISPEKAYHEQLTVAQITNMCFDPNNQ 1212 Query: 232 MAACD 246 M CD Sbjct: 1213 MVKCD 1217 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 65.3 bits (152), Expect = 7e-12 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV E+T F+ N Sbjct: 167 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNSCFEPANQ 226 Query: 232 MAACD 246 M CD Sbjct: 227 MVKCD 231 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 64.9 bits (151), Expect = 1e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV ++T F+ N Sbjct: 613 LRFDGALNVDLTEFQTNLVPYPRIHFPMASYAPVVSAEKAYHEQLTVADITNSCFEPANQ 672 Query: 232 MAACD 246 M CD Sbjct: 673 MVKCD 677 Score = 59.3 bits (137), Expect = 5e-10 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV E+T F+ N Sbjct: 1046 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQ 1105 Query: 232 M 234 M Sbjct: 1106 M 1106 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 64.9 bits (151), Expect = 1e-11 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV E+T F+ N Sbjct: 242 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQ 301 Query: 232 MAACD 246 M CD Sbjct: 302 MVKCD 306 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 64.9 bits (151), Expect = 1e-11 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV E+T F+ N Sbjct: 227 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITTSCFEPANQ 286 Query: 232 MAACD 246 M CD Sbjct: 287 MVKCD 291 Score = 56.0 bits (129), Expect = 4e-09 Identities = 23/59 (38%), Positives = 34/59 (57%) Frame = +1 Query: 70 LNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACD 246 LN DL + N+VP+PR+HF + +AP+ S + +TV +LT F+ N M CD Sbjct: 664 LNVDLMEFQTNLVPYPRIHFPMATYAPIISAEKAYHEMMTVSDLTNACFEPANQMVKCD 722 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 64.9 bits (151), Expect = 1e-11 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV E+T F+ N Sbjct: 675 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQ 734 Query: 232 MAACD 246 M CD Sbjct: 735 MVKCD 739 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 242 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 301 Query: 232 MAACD 246 M CD Sbjct: 302 MVKCD 306 >SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 232 Score = 63.7 bits (148), Expect = 2e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV ++T F+ N Sbjct: 40 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQ 99 Query: 232 MAACD 246 M CD Sbjct: 100 MVKCD 104 >SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) Length = 380 Score = 63.7 bits (148), Expect = 2e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV ++T F+ N Sbjct: 241 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQ 300 Query: 232 MAACD 246 M CD Sbjct: 301 MVKCD 305 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 63.7 bits (148), Expect = 2e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + +TV +LT F+ N Sbjct: 207 LRFDGALNVDLTEFQTNLVPYPRIHFPMATYAPIISAEKAYHEMMTVSDLTNACFEPANQ 266 Query: 232 MAACD 246 M CD Sbjct: 267 MVKCD 271 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 179 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 238 Query: 232 MAACD 246 M CD Sbjct: 239 MVKCD 243 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 306 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 365 Query: 232 MAACD 246 M CD Sbjct: 366 MVKCD 370 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 827 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 886 Query: 232 MAACD 246 M CD Sbjct: 887 MVKCD 891 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 167 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 226 Query: 232 MAACD 246 M CD Sbjct: 227 MVKCD 231 >SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 250 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 40 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 99 Query: 232 MAACD 246 M CD Sbjct: 100 MVKCD 104 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 63.3 bits (147), Expect = 3e-11 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ S + L+V E+T F+ N Sbjct: 242 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQ 301 Query: 232 MAACD 246 M CD Sbjct: 302 MVKCD 306 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 61.3 bits (142), Expect = 1e-10 Identities = 25/65 (38%), Positives = 37/65 (56%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELTQQMFDAKNM 231 LRF G LN DL + N+VP+PR+HF + +AP+ + ++V E+T F+ N Sbjct: 373 LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIGADKAYHENMSVAEITSACFEPSNQ 432 Query: 232 MAACD 246 M CD Sbjct: 433 MVKCD 437 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 54.0 bits (124), Expect = 2e-08 Identities = 23/51 (45%), Positives = 32/51 (62%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTSRGSQQYRALTVPELT 204 LRF G LN DL + N+VP+PR+HF + +AP+ S + LTV E+T Sbjct: 232 LRFDGSLNVDLNEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEIT 282 >SB_16885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 50.4 bits (115), Expect = 2e-07 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = +1 Query: 46 TCLRFPGQLNADLRKLAVNMVPFPRLHFFITGFAPLTS 159 T LR+PG +N DL L +++P PRLHF +TG+ PLT+ Sbjct: 277 TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTT 314 >SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) Length = 488 Score = 44.8 bits (101), Expect = 1e-05 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +1 Query: 55 RFPGQLNADLRKLAVNMVPFPRLHFFITGFAPL 153 RF G LN DL ++ +N+VPFP+LH+ ++ PL Sbjct: 290 RFEGSLNVDLNEITMNLVPFPKLHYLVSSQTPL 322 >SB_23746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 31.5 bits (68), Expect = 0.11 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAAR--REGSKTSNKKVQTWEW 109 T HHVL+V+H+L + DGE+ + A+ +G S+ + + +W Sbjct: 709 TGSHHVLTVDHVLGMIADGEKKCTVCGAQLLLQGYTKSHPQCFSIDW 755 >SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) Length = 139 Score = 31.1 bits (67), Expect = 0.14 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 52 LRFPGQLNADLRKLAVNMVPFP 117 LRF G LN DL + N+VP+P Sbjct: 117 LRFDGALNVDLTEFQTNLVPYP 138 >SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1748 Score = 31.1 bits (67), Expect = 0.14 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 TR HHVL+V+H+L + D E+ L Sbjct: 1676 TRTHHVLTVDHVLGMIADAEKKCTL 1700 >SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 680 Score = 29.1 bits (62), Expect = 0.58 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+VEH+L + D E+ Sbjct: 619 TGSHHVLTVEHVLGMIADAEK 639 >SB_2876| Best HMM Match : Peptidase_C2 (HMM E-Value=2.8) Length = 947 Score = 29.1 bits (62), Expect = 0.58 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVL 172 T HHVL+V+H+L + D E+ L Sbjct: 877 TGPHHVLTVDHVLGMIADAEKCTL 900 >SB_4950| Best HMM Match : ResIII (HMM E-Value=1.4) Length = 766 Score = 28.7 bits (61), Expect = 0.77 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 TR HHVL+V+H+L + D ++ Sbjct: 711 TRPHHVLTVDHVLGTIADADK 731 >SB_4866| Best HMM Match : DUF1509 (HMM E-Value=3.8) Length = 1065 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER--AVLLTAARREGSKTSNKKVQT 118 T HHVL+V+H+L + D E+ V T +G N V T Sbjct: 1021 TGSHHVLTVDHVLGMIADAEKNCTVCGTQLLFQGYTIPNASVST 1064 >SB_43900| Best HMM Match : ResIII (HMM E-Value=0.53) Length = 540 Score = 28.3 bits (60), Expect = 1.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAAR 157 T HHVL+V+H+L + D E+ L ++ Sbjct: 469 TGPHHVLTVDHVLGMIADAEKKCTLCGSQ 497 >SB_30086| Best HMM Match : LIM (HMM E-Value=0.5) Length = 715 Score = 28.3 bits (60), Expect = 1.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAARREGSKTSN 133 T HHVL+V+H+L + D E+ + +G S+ Sbjct: 646 TGSHHVLTVDHVLGMIADAEKKCTVCGTLFQGYPKSH 682 >SB_56953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 678 TGSHHVLTVDHVLGMIADAEK 698 >SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1037 TGPHHVLTVDHVLGMIADAEKKCTL 1061 >SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 708 TGPHHVLTVDHVLGMIADAEKKCTL 732 >SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) Length = 755 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 684 TGSHHVLTVDHVLGMIADAEK 704 >SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) Length = 1130 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1051 TGPHHVLTVDHVLGMIADAEKKCTL 1075 >SB_52418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 422 TGSHHVLTVDHVLGMIADAEK 442 >SB_44150| Best HMM Match : LIM (HMM E-Value=0.3) Length = 772 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 701 TGSHHVLTVDHVLGMIADAEK 721 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1362 TGSHHVLTVDHVLGMIADAEK 1382 >SB_37605| Best HMM Match : LIM (HMM E-Value=2.4) Length = 610 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 539 TGPHHVLTVDHVLGMIADAEKKCTL 563 >SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 1066 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 971 TGSHHVLTVDHVLGMIADAEK 991 >SB_29109| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 269 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 214 TGPHHVLTVDHVLGMIADAEKKCTL 238 >SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERA 178 T HHVL+V H+L + D ER+ Sbjct: 785 TGSHHVLTVGHVLGMIADAERS 806 >SB_22252| Best HMM Match : C1_1 (HMM E-Value=2.6) Length = 333 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 262 TGPHHVLTVDHVLGMIADAEKKCTL 286 >SB_21218| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 352 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 290 TGPHHVLTVDHVLGMIADAEKKCTL 314 >SB_19129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 847 TGPHHVLTVDHVLGMIADAEKKCTL 871 >SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 967 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 872 TGSHHVLTVDHVLGMIADAEK 892 >SB_13016| Best HMM Match : ResIII (HMM E-Value=0.62) Length = 450 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 358 TGSHHVLTVDHVLGMIADAEK 378 >SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVL 172 T HHVL+V+H+L + D E+ + Sbjct: 1050 TGPHHVLTVDHVLGMIADAEKCTV 1073 >SB_4092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 222 TGLHHVLTVDHVLGMIADAEKKCTL 246 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1024 TGPHHVLTVDHVLGMIADAEKKCTL 1048 >SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 932 TGPHHVLTVDHVLGMIADAEKKCTL 956 >SB_59009| Best HMM Match : DEAD (HMM E-Value=0.87) Length = 957 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 898 TGPHHVLTVDHVLGMIADAEKKCTL 922 >SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) Length = 743 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 467 TGSHHVLTVDHVLGMIADAEK 487 >SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 533 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 471 TGPHHVLTVDHVLGMIADAEKKCTL 495 >SB_52039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 143 TGPHHVLTVDHVLGMIADAEKKCTL 167 >SB_46105| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 81 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 31 TGPHHVLTVDHVLGMIADAEKKCTL 55 >SB_45980| Best HMM Match : C1_3 (HMM E-Value=4.6) Length = 771 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 259 TGSHHVLTVDHVLGMIADAEK 279 >SB_44861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 757 TGSHHVLTVDHVLGMIADAEK 777 >SB_44503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1347 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1276 TGSHHVLTVDHVLGMIADSEK 1296 >SB_43547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 674 TGSHHVLTVDHVLGMIADAEK 694 >SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1130 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1059 TGSHHVLTVDHVLGMIADAEK 1079 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1072 TGPHHVLTVDHVLGMIADAEKKCTL 1096 >SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 998 TGPHHVLTVDHVLGMIADAEKKCTL 1022 >SB_30288| Best HMM Match : P19Arf_N (HMM E-Value=6.8) Length = 256 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 98 TGSHHVLTVDHVLGMIADAEK 118 >SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1395 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1324 TGSHHVLTVDHVLGMIADAEK 1344 >SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1028 TGPHHVLTVDHVLGMIADAEKKCTL 1052 >SB_24617| Best HMM Match : C1_1 (HMM E-Value=2.6) Length = 333 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 262 TGPHHVLTVDHVLGMIADAEKKCTL 286 >SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) Length = 1275 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 741 TGSHHVLTVDHVLGMIADAEK 761 >SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1101 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1042 TGPHHVLTVDHVLGMIADAEKKCTL 1066 >SB_3379| Best HMM Match : NHase_beta (HMM E-Value=2.8) Length = 233 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERA 178 T HHVL+V+H+L + D E++ Sbjct: 200 TGPHHVLTVDHVLGMIADAEKS 221 >SB_2283| Best HMM Match : LIM (HMM E-Value=1.4) Length = 336 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 265 TGPHHVLTVDHVLGMIADAEKKCTL 289 >SB_53256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 183 RAVLLTAARREGSKTSNKKVQTWEWHHVHCQLTEI 79 R L RR+ T+ KK+QT +WH + TE+ Sbjct: 3 RIARLDKLRRDRQMTALKKLQTLKWHKDARKYTEV 37 >SB_48293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1103 TGPHHVLTVDHVLGMIADAEK 1123 >SB_48274| Best HMM Match : LIM (HMM E-Value=0.38) Length = 590 Score = 27.5 bits (58), Expect = 1.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 234 HHVLSVEHLLRQLGDGERAVL 172 HHVL+V+H+L + D E+ + Sbjct: 523 HHVLTVDHVLGMIADAEKCTV 543 >SB_44046| Best HMM Match : P19Arf_N (HMM E-Value=5.5) Length = 337 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 304 TGPHHVLTVDHVLGMIADAEK 324 >SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) Length = 1244 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1165 TGPHHVLTVDHVLGMIADAEK 1185 >SB_32881| Best HMM Match : DUF75 (HMM E-Value=1.7) Length = 462 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 401 TGPHHVLTVDHVLGMIADAEK 421 >SB_30838| Best HMM Match : ResIII (HMM E-Value=0.13) Length = 327 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 240 TGPHHVLTVDHVLGMIADAEK 260 >SB_28107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 858 TGPHHVLTVDHVLGMIADAEK 878 >SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) Length = 1097 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1026 TGPHHVLTVDHVLGMIADAEK 1046 >SB_24572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 961 TGPHHVLTVDHVLGMIADAEK 981 >SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 234 HHVLSVEHLLRQLGDGERAVLL 169 HHVL+V+H+L + D E+ L Sbjct: 935 HHVLTVDHVLGMIADAEKKCTL 956 >SB_21028| Best HMM Match : LIM (HMM E-Value=0.44) Length = 192 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 121 TGPHHVLTVDHVLGMIADAEK 141 >SB_18996| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) Length = 475 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 366 TGPHHVLTVDHVLGMIADAEK 386 >SB_16974| Best HMM Match : LIM (HMM E-Value=0.38) Length = 677 Score = 27.5 bits (58), Expect = 1.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 234 HHVLSVEHLLRQLGDGERAVL 172 HHVL+V+H+L + D E+ + Sbjct: 610 HHVLTVDHVLGMIADAEKCTV 630 >SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2214 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 1336 TGPHHVLTVDHVLGMIDDAEKKCTL 1360 >SB_12073| Best HMM Match : LIM (HMM E-Value=0.49) Length = 500 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 429 TGPHHVLTVDHVLGMIADAEK 449 >SB_5789| Best HMM Match : LIM (HMM E-Value=0.44) Length = 233 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 162 TGLHHVLTVDHVLGMIADAEK 182 >SB_2879| Best HMM Match : zf-C4_Topoisom (HMM E-Value=2) Length = 610 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 523 TGPHHVLTVDHVLCMIADAEKKCTL 547 >SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) Length = 1161 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1090 TGPHHVLTVDHVLGMIADAEK 1110 >SB_58059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 993 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 922 TGPHHVLTVDHVLGMIADAEK 942 >SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) Length = 968 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 883 TGPHHVLTVDHVLGMIADAEK 903 >SB_52692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 621 TGPHHVLTVDHVLGMIADAEK 641 >SB_44063| Best HMM Match : LIM (HMM E-Value=0.85) Length = 143 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 72 TGPHHVLTVDHVLGMIADAEK 92 >SB_41732| Best HMM Match : LIM (HMM E-Value=0.84) Length = 102 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 31 TGPHHVLTVDHVLGMIADAEK 51 >SB_38051| Best HMM Match : LIM (HMM E-Value=0.34) Length = 168 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 97 TGPHHVLTVDHVLGMIADAEK 117 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 831 TGPHHVLTVDHVLGMIADAEK 851 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 769 TGPHHVLTVDHVLGMIADAEK 789 >SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 1175 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 1104 TGPHHVLTVDHVLGMIADAEK 1124 >SB_16256| Best HMM Match : LIM (HMM E-Value=0.39) Length = 314 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 243 TGPHHVLTVDHVLGMIADAEK 263 >SB_15851| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) Length = 173 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 121 TGPHHVLTVDHVLGMIADAEK 141 >SB_12984| Best HMM Match : zf-C4_Topoisom (HMM E-Value=4.6) Length = 141 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 31 TGPHHVLTVDHVLGMIADAEK 51 >SB_12490| Best HMM Match : DEAD (HMM E-Value=1.6) Length = 445 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL-TAARREGS 145 T HVL+V+H+L + D E+ + A R+ GS Sbjct: 402 TGSQHVLTVDHVLGMIADAEKKCMYRPAGRQSGS 435 >SB_10610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERA 178 T HHVL+V+H+L + D +R+ Sbjct: 529 TGPHHVLTVDHVLGMIADAKRS 550 >SB_6355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 826 TGPHHVLTVDHVLGMIADAEK 846 >SB_5118| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) Length = 425 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 373 TGPHHVLTVDHVLGMIADAEK 393 >SB_3087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 72 TGPHHVLTVDHVLGMIADAEK 92 >SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL V+H+L + D E+ Sbjct: 858 TGPHHVLKVDHVLGMIADAEK 878 >SB_40687| Best HMM Match : PADR1 (HMM E-Value=0.23) Length = 733 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L ++ D E+ Sbjct: 654 TGSHHVLTVDHVLGRIADVEK 674 >SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+++H+L + D E+ Sbjct: 1014 TVSHHVLTIDHVLGMIADAEK 1034 >SB_27760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 27.1 bits (57), Expect = 2.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ L Sbjct: 173 TGPHHVLTVDHVLGMITDAEKKYTL 197 >SB_24924| Best HMM Match : WHEP-TRS (HMM E-Value=1.1) Length = 1002 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 941 TGSHHVLTVDHVLGVIADAEK 961 >SB_16594| Best HMM Match : DUF1265 (HMM E-Value=2.6) Length = 734 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAAR 157 T HHVL+V+H+L + + E+ L+ + Sbjct: 663 TGPHHVLTVDHVLGMIAEAEKKCTLSGTQ 691 >SB_15299| Best HMM Match : LIM (HMM E-Value=0.44) Length = 344 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 234 HHVLSVEHLLRQLGDGER 181 HHVL+V+H+L + D E+ Sbjct: 276 HHVLTVDHVLGMIADAEK 293 >SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) Length = 595 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 234 HHVLSVEHLLRQLGDGER 181 HHVL+V+H+L + D E+ Sbjct: 527 HHVLTVDHVLGMIADAEK 544 >SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) Length = 789 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 234 HHVLSVEHLLRQLGDGER 181 HHVL+V+H+L + D E+ Sbjct: 704 HHVLTVDHVLGMIADAEK 721 >SB_25592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAAR 157 T HHVL+V+H+L + + E+ + A+ Sbjct: 659 TGSHHVLTVDHVLGMIAEAEKKCTVCGAQ 687 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER---AVLLTAARREGS 145 T HVL+V+H+L + D E+ AV L+ RE S Sbjct: 1120 TGSQHVLTVDHVLGMIADAEKKCTAVALSFCFRESS 1155 >SB_6028| Best HMM Match : LIM (HMM E-Value=0.22) Length = 968 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+++H+L + D E+ Sbjct: 866 TGLHHVLTIDHVLGMIADAEK 886 >SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H++ + D E+ Sbjct: 971 TGPHHVLTVDHVIGMIADAEK 991 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGE 184 T HHVL+V+H+L + D E Sbjct: 468 TGPHHVLTVDHVLGMIADAE 487 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H++ + D E+ Sbjct: 905 TGPHHVLTVDHVIGMIADAEK 925 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ ++ Sbjct: 1033 TGPHHVLTVDHVLVMITDAEKKCMV 1057 >SB_41935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + + E+ ++ Sbjct: 245 TGSHHVLTVDHVLGMIAEAEKKCMV 269 >SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 605 TGPHHVLTVDHVLGMITDAEK 625 >SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + D E+ ++ Sbjct: 528 TGPHHVLTVDHVLVMITDAEKKCMV 552 >SB_8850| Best HMM Match : LIM (HMM E-Value=0.51) Length = 1039 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D E+ Sbjct: 968 TGSHHVLTVDHVLGMIADVEK 988 >SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) Length = 1037 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D ++ Sbjct: 966 TGPHHVLTVDHVLGMIADADK 986 >SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAAR 157 T HHVL+V+H+L + + E+ + A+ Sbjct: 898 TGSHHVLTVDHVLGMIAETEKKCTVCGAQ 926 >SB_43440| Best HMM Match : PADR1 (HMM E-Value=0.45) Length = 942 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D ++ Sbjct: 881 TGSHHVLTVDHVLGMIADAKK 901 >SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) Length = 439 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL V+H+L + D E+ L Sbjct: 356 TGPHHVLMVDHVLGMITDAEKKCTL 380 >SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLLTAARR 154 T HH+L+V H+L + D E+ + +R Sbjct: 817 TGSHHLLTVYHVLGMIADAEKKCTVCGTQR 846 >SB_1571| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-16) Length = 265 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -1 Query: 99 HCQLTEIGIQLTGKPEAGVTPDMVSDTRSSC 7 H + G+ L G+P+A + ++ + R SC Sbjct: 77 HSPTSPSGLPLRGRPKADIVNKLIQEGRQSC 107 >SB_58744| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 831 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + + E+ Sbjct: 761 TGSHHVLTVDHVLGMIAEAEK 781 >SB_40444| Best HMM Match : LIM (HMM E-Value=3.4) Length = 304 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T HHVL+V+H+L + + E+ L Sbjct: 233 TGPHHVLTVDHVLGMIAEAEKKCTL 257 >SB_27544| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 522 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + + E+ Sbjct: 452 TGSHHVLTVDHVLGMIAEAEK 472 >SB_51277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGE 184 T HHVL+V+H+L + D + Sbjct: 173 TGSHHVLTVDHVLGMIADAD 192 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + + E+ Sbjct: 923 TGPHHVLTVDHVLGMIAEAEK 943 >SB_42507| Best HMM Match : ResIII (HMM E-Value=0.75) Length = 1056 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D ++ Sbjct: 990 TGPHHVLTVDHVLVMIADADK 1010 >SB_56648| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.92) Length = 240 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + + E+ Sbjct: 169 TGPHHVLTVDHVLGMIANAEK 189 >SB_43151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = -1 Query: 210 LLRQLGDGERAVLLTAARREGSKTSNKKVQ 121 +LRQ+ ERA L++A REG + + +KV+ Sbjct: 1062 ILRQIRSDERAALISA--REGEERTYQKVK 1089 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + + E+ Sbjct: 913 TGPHHVLTVDHVLGMIANAEK 933 >SB_13843| Best HMM Match : PADR1 (HMM E-Value=2) Length = 252 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T H+VL+V+H+L + D E+ Sbjct: 181 TGSHYVLTVDHVLGMIADAEK 201 >SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 25.4 bits (53), Expect = 7.1 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 144 KTSNKKVQTWEWHHVHCQLTEIGIQLTGKPEA-GVTPDMVSDTRSSCRI 1 K+ ++Q H+++ L E+ G GVTP+++S T C I Sbjct: 811 KSIKLRMQDHTSHYINLPLMELAEDKLGISNIPGVTPNLISGTHLFCAI 859 >SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 25.4 bits (53), Expect = 7.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 33 CLALHLPQVSRSVECRSP 86 CL +HL +VS+ +C+ P Sbjct: 735 CLVVHLQKVSQCTDCKMP 752 >SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T H+VL+V+H+L + DG++ Sbjct: 965 TGPHNVLTVDHVLGMIADGKK 985 >SB_50233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 967 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + + E+ Sbjct: 903 TGPHHVLTVDHVLGMIANAEK 923 >SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T +HVL+V+H+L + D E+ L Sbjct: 1065 TGPYHVLTVDHVLGMIADAEKKCTL 1089 >SB_20194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 846 Score = 25.4 bits (53), Expect = 7.1 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER--AVLLTAARREGSKTSNKKVQTWEW 109 T HHVL+V+H+L + E+ V T +G S+ + + +W Sbjct: 545 TGSHHVLTVDHVLGMIAGAEKRCTVCGTQLLYQGYTKSHPQCFSIDW 591 >SB_15232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = -1 Query: 210 LLRQLGDGERAVLLTAARREGSKTSNKKVQ 121 +LRQ+ ERA L++A REG + + +KV+ Sbjct: 96 ILRQIRSDERAALISA--REGEERTYQKVK 123 >SB_57683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+ + D E+ Sbjct: 337 TGPHHVLTVDHVSGMIADAEK 357 >SB_52907| Best HMM Match : RVT_1 (HMM E-Value=2.4e-17) Length = 344 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 237 RHHVLSVEHLLRQLGDG 187 RH + SVEH L QLG G Sbjct: 103 RHMLPSVEHTLAQLGGG 119 >SB_38724| Best HMM Match : DUF1684 (HMM E-Value=2.2) Length = 373 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T +HVL+V+H+L + D E+ Sbjct: 334 TGPYHVLTVDHVLGMIADAEK 354 >SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1399 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 176 YC*LPRDVRGAKPVIKKCRRGNGTMFTASLR 84 YC PR +G+KP++ + R G+ TA LR Sbjct: 159 YCTQPRVFKGSKPMVLQGRSGSHGS-TADLR 188 >SB_23236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGD 190 T HHVL+V+H+L + D Sbjct: 68 TGSHHVLTVDHVLGMIAD 85 >SB_5381| Best HMM Match : PAN (HMM E-Value=7.2e-05) Length = 306 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 65 PGNLRQV*RQTWSATP 18 PGN RQ + WS+TP Sbjct: 33 PGNARQSMNEVWSSTP 48 >SB_50667| Best HMM Match : LIM (HMM E-Value=0.95) Length = 318 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGER 181 T HHVL+V+H+L + D ++ Sbjct: 247 TGPHHVLTVDHVLGMIADVDK 267 >SB_39546| Best HMM Match : FCH (HMM E-Value=8e-13) Length = 360 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 151 LTSRGSQQYRALTVPELTQQMFDAKNMM 234 L S+ S Q ++T P+L Q + D KN++ Sbjct: 92 LVSQFSNQVSSITFPKLEQLIQDKKNLL 119 >SB_26900| Best HMM Match : LIM (HMM E-Value=0.63) Length = 333 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 243 TRRHHVLSVEHLLRQLGDGERAVLL 169 T +HVL+V+H+L + D E+ L Sbjct: 262 TGPNHVLTVDHVLGMIADAEKKCTL 286 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 151 LTSRGSQQYRALTVPELTQQMFDAKNMM 234 L S+ S Q ++T P+L Q + D KN++ Sbjct: 92 LVSQFSNQVSSITFPKLEQLIQDKKNLL 119 >SB_13616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 69 LTGKPEAGVTPDMVSDTRSSCRI 1 +TGKPE+G+ M R+ C + Sbjct: 6 MTGKPESGIHEKMRLGIRNQCNV 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,627,210 Number of Sequences: 59808 Number of extensions: 122939 Number of successful extensions: 521 Number of sequences better than 10.0: 163 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 16,821,457 effective HSP length: 59 effective length of database: 13,292,785 effective search space used: 292441270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -