BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J10 (424 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003581-1|AAO39585.1| 946|Drosophila melanogaster LD17329p pro... 30 1.1 AE014297-767|AAF54252.3| 1399|Drosophila melanogaster CG31258-PA... 30 1.1 AF241364-1|AAF98386.1| 507|Drosophila melanogaster cleavage and... 29 3.4 AE013599-1901|AAF58240.1| 1455|Drosophila melanogaster CG10110-P... 29 3.4 BT023501-1|AAY84901.1| 919|Drosophila melanogaster LD27033p pro... 28 5.9 AY121661-1|AAM51988.1| 650|Drosophila melanogaster RE10344p pro... 28 5.9 AF145646-1|AAD38621.1| 418|Drosophila melanogaster BcDNA.GH0792... 28 5.9 AE014296-1769|AAN11939.1| 919|Drosophila melanogaster CG8108-PB... 28 5.9 AE014296-1768|AAF50193.1| 919|Drosophila melanogaster CG8108-PA... 28 5.9 AE013599-2329|AAF57964.2| 650|Drosophila melanogaster CG30463-P... 28 5.9 AE013599-2328|AAF57966.2| 650|Drosophila melanogaster CG30463-P... 28 5.9 >BT003581-1|AAO39585.1| 946|Drosophila melanogaster LD17329p protein. Length = 946 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -2 Query: 180 SQCPSRRGMKSGIEYHQLWVVQSPPADRAVRLSREPLEPGPPIQRESTGNAYRRPLVA 7 S P K + + V PA++ + LS+EP EP P+Q + T A R P++A Sbjct: 175 SSTPCTEKQKEEVAKNTTRVETDKPAEKPMELSQEP-EPENPLQTKVTSPA-RNPILA 230 >AE014297-767|AAF54252.3| 1399|Drosophila melanogaster CG31258-PA protein. Length = 1399 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -2 Query: 180 SQCPSRRGMKSGIEYHQLWVVQSPPADRAVRLSREPLEPGPPIQRESTGNAYRRPLVA 7 S P K + + V PA++ + LS+EP EP P+Q + T A R P++A Sbjct: 175 SSTPCTEKQKEEVAKNTTRVETDKPAEKPMELSQEP-EPENPLQTKVTSPA-RNPILA 230 >AF241364-1|AAF98386.1| 507|Drosophila melanogaster cleavage and polyadenylation specificityfactor protein. Length = 507 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = +1 Query: 118 YNPQLMILYS*LHSTTGRTLTPVETTTTIRIILLKNLS*FPIYWPCSRST*SLHFNL*MI 297 Y P L+ILY + + GR +T + I L PI W + SL F+ + Sbjct: 224 YEPTLLILYEPVRTCPGRIKVRSDTCVLVAISLNIQQRVHPIIWTVN----SLPFDCLQV 279 Query: 298 YP 303 YP Sbjct: 280 YP 281 >AE013599-1901|AAF58240.1| 1455|Drosophila melanogaster CG10110-PA, isoform A protein. Length = 1455 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = +1 Query: 118 YNPQLMILYS*LHSTTGRTLTPVETTTTIRIILLKNLS*FPIYWPCSRST*SLHFNL*MI 297 Y P L+ILY + + GR +T + I L PI W + SL F+ + Sbjct: 224 YEPTLLILYEPVRTCPGRIKVRSDTCVLVAISLNIQQRVHPIIWTVN----SLPFDCLQV 279 Query: 298 YP 303 YP Sbjct: 280 YP 281 >BT023501-1|AAY84901.1| 919|Drosophila melanogaster LD27033p protein. Length = 919 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 264 RARTRPIYRELAQVLQQNNSNRCCRLHRSQCPSRRGMKSGIEYHQ 130 RAR R RE+ + ++ + +R CRL R + + E+H+ Sbjct: 517 RARQRTTQREIEENSKEEHESRYCRLCRLAYRQPKNLHQASEHHK 561 >AY121661-1|AAM51988.1| 650|Drosophila melanogaster RE10344p protein. Length = 650 Score = 27.9 bits (59), Expect = 5.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 101 IGLFVCHGSRSSQGHQYNESQREMH 27 + LF CHG + +Q Y E+ +++H Sbjct: 585 VTLFGCHGGKGNQFWTYRENTKQLH 609 >AF145646-1|AAD38621.1| 418|Drosophila melanogaster BcDNA.GH07921 protein. Length = 418 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 264 RARTRPIYRELAQVLQQNNSNRCCRLHRSQCPSRRGMKSGIEYHQ 130 RAR R RE+ + ++ + +R CRL R + + E+H+ Sbjct: 16 RARQRTTQREIEENSKEEHESRYCRLCRLAYRQPKNLHQASEHHK 60 >AE014296-1769|AAN11939.1| 919|Drosophila melanogaster CG8108-PB, isoform B protein. Length = 919 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 264 RARTRPIYRELAQVLQQNNSNRCCRLHRSQCPSRRGMKSGIEYHQ 130 RAR R RE+ + ++ + +R CRL R + + E+H+ Sbjct: 517 RARQRTTQREIEENSKEEHESRYCRLCRLAYRQPKNLHQASEHHK 561 >AE014296-1768|AAF50193.1| 919|Drosophila melanogaster CG8108-PA, isoform A protein. Length = 919 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 264 RARTRPIYRELAQVLQQNNSNRCCRLHRSQCPSRRGMKSGIEYHQ 130 RAR R RE+ + ++ + +R CRL R + + E+H+ Sbjct: 517 RARQRTTQREIEENSKEEHESRYCRLCRLAYRQPKNLHQASEHHK 561 >AE013599-2329|AAF57964.2| 650|Drosophila melanogaster CG30463-PB, isoform B protein. Length = 650 Score = 27.9 bits (59), Expect = 5.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 101 IGLFVCHGSRSSQGHQYNESQREMH 27 + LF CHG + +Q Y E+ +++H Sbjct: 585 VTLFGCHGGKGNQFWTYRENTKQLH 609 >AE013599-2328|AAF57966.2| 650|Drosophila melanogaster CG30463-PA, isoform A protein. Length = 650 Score = 27.9 bits (59), Expect = 5.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 101 IGLFVCHGSRSSQGHQYNESQREMH 27 + LF CHG + +Q Y E+ +++H Sbjct: 585 VTLFGCHGGKGNQFWTYRENTKQLH 609 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,033,921 Number of Sequences: 53049 Number of extensions: 305916 Number of successful extensions: 849 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1292733852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -