BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J09 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 0.64 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 1.9 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 1.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 2.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 2.6 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 4.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 0.64 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 226 HPHIPPNSSGPPI 264 HP IPP S PP+ Sbjct: 1375 HPPIPPTSEKPPL 1387 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.2 bits (45), Expect = 1.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 364 TDTRRRSAPNRNGNHDTRV*GSKPAGPSRR 275 TD +RR+ P R + R ++PA P+ R Sbjct: 321 TDHQRRNEPKRPRPNIDRHEVTRPAAPANR 350 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 178 CVRTCSARRRDKLK 219 C+RTCS+ +R K + Sbjct: 192 CLRTCSSAKRPKFE 205 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 2.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 177 LRSYLLGEAARQTEANPPPHPPQQ 248 L+S L A + PPPHP Q Sbjct: 721 LQSPLTPHEAFDVKLPPPPHPHHQ 744 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 2.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 177 LRSYLLGEAARQTEANPPPHPPQQ 248 L+S L A + PPPHP Q Sbjct: 613 LQSPLTPHEAFDVKLPPPPHPHHQ 636 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 4.5 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 304 GSKPAGPSRRIRA*WAAPSCWGGCGGGFASVCLAASPSRY 185 G++ G S + A +APS G GG V S RY Sbjct: 246 GAQTVGASFGLHATGSAPSPTAGAGGLPPQVPSPRSQRRY 285 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,322 Number of Sequences: 336 Number of extensions: 1824 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -