BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_J04 (439 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 26 0.16 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 26 0.16 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 24 0.64 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 1.5 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 1.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 3.4 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.5 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.5 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.5 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.5 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.5 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.5 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 4.5 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 4.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 5.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 5.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 5.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 5.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 5.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 5.9 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 5.9 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 26.2 bits (55), Expect = 0.16 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +1 Query: 79 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKY 204 KN++ +++Y+ K R +T+ K + N YN Y Sbjct: 273 KNEREYRKYRETSKGRSRDRTERERSKETKIISSNNYNYKNY 314 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 26.2 bits (55), Expect = 0.16 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +1 Query: 79 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKY 204 KN++ +++Y+ K R +T+ K + N YN Y Sbjct: 284 KNEREYRKYRETSKGRSRDRTERERSKETKIISSNNYNYKNY 325 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 24.2 bits (50), Expect = 0.64 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 262 CVSMQLDR*HLYWITVQSVGTLECCICFYPGQRGVCEHSSQFFP 131 C S+ L +L+W+ V GT ++P G EH S+FFP Sbjct: 29 CTSLNLS--NLFWLFV---GT------YFPSLIGANEHYSKFFP 61 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQVAY 255 TD RK ++ +++ K ++ ++V + N+D +AY Sbjct: 288 TDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAY 326 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 221 NRTISRYFGVLYLFLSWTTRRLRA**SVFPSRRLLNLTW 105 N Y ++L SW RLR ++ R+L++ W Sbjct: 45 NEESMTYVADIFLAQSWRDSRLRLPENMSEDYRILDVDW 83 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 187 ICFYPGQRGVCEHSSQFFPH 128 +C +PG +CE F H Sbjct: 282 VCKWPGCEVICEDYQAFLKH 301 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 305 CLLRMSRPGKKITKKTILG 323 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 305 CLLRMSRPGKKITKKTILG 323 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 305 CLLRMSRPGKKITKKTILG 323 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 305 CLLRMSRPGKKITKKTILG 323 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 305 CLLRMSRPGKKITKKTILG 323 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 305 CLLRMSRPGKKITKKTILG 323 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 373 CLLRMSRPGKKITKKTILG 391 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 348 CLLHWSVAGKKIVAEARLG 404 CLL S GKKI + LG Sbjct: 373 CLLRMSRPGKKITKKTILG 391 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNK 231 + +Y+R+R +D+N+ K R +L N+ Sbjct: 228 SSHYSRERSCSRDRNREYRKKDRRYEKLHNE 258 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNK 231 + +Y+R+R +D+N+ K R +L N+ Sbjct: 228 SSHYSRERSCSRDRNREYRKKDRRYEKLHNE 258 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNK 231 + +Y+R+R +D+N+ K R +L N+ Sbjct: 228 SSHYSRERSCSRDRNREYRKKDRRYEKLHNE 258 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNK 231 + +Y+R+R +D+N+ K R +L N+ Sbjct: 228 SSHYSRERSCSRDRNREYRKKDRRYEKLHNE 258 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNK 231 + +Y+R+R +D+N+ K R +L N+ Sbjct: 217 SSHYSRERSCSRDRNREYRKKDRRYEKLHNE 247 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 139 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNK 231 + +Y+R+R +D+N+ K R +L N+ Sbjct: 228 SSHYSRERSCSRDRNREYKEKDRRYEKLHNE 258 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 70 KVVKNKQYFKRYQVKFKRRREGKTD 144 K KN+ +++Y+ K R KT+ Sbjct: 286 KSYKNENSYRKYRETSKERSRDKTE 310 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,978 Number of Sequences: 438 Number of extensions: 2441 Number of successful extensions: 25 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -