BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I22 (507 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 23 2.4 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 22 4.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 5.6 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 366 LTVIDDPKYKRTLYKLCNNNIVTFKKLLEGNDDGVMRND 482 +T+ + K + L K+C+ T K+LL+G G D Sbjct: 27 MTIEEAKKTIKNLRKVCSKKNDTPKELLDGQFRGEFPQD 65 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 21.8 bits (44), Expect = 4.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 366 LTVIDDPKYKRTLYKLCNNNIVTFKKLLEGNDDGVMRND 482 +T+ + K + L K+C+ T K+LL+G G D Sbjct: 1 MTIEELKKTIKNLRKVCSKKNDTPKELLDGQFRGEFPQD 39 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 Query: 42 DCDTLRQRTADAILPM 89 DCDTL R + P+ Sbjct: 570 DCDTLEYRNGEVTTPL 585 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,956 Number of Sequences: 438 Number of extensions: 2793 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -